Transcription Factor
| Accessions: | 6oen_N (3D-footprint 20231221) |
| Names: | High mobility group protein 1, High mobility group protein B1, HMG-1, HMGB1_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P09429 |
| Length: | 36 |
| Pfam Domains: | 1-35 HMG (high mobility group) box |
| Sequence: (in bold interface residues) | 1 PSAFFLFCSEYRPKIKGEHPGIGDVAKKLGEMWNNT |
| Interface Residues: | 2, 4, 5, 8, 12, 22, 23, 24, 26 |
| 3D-footprint Homologues: | 1j5n_A, 4s2q_D, 6jrp_D, 7m5w_A, 1hry_A, 3u2b_C, 1qrv_A, 2gzk_A |
| Binding Motifs: | 6oen_ADN GTnnnnnnnnnnnctnnnnnTG |
| Binding Sites: | 6oen_G 6oen_J |
| Publications: | Chen X, Cui Y, Best RB, Wang H, Zhou ZH, Yang W, Gellert M. Cutting antiparallel DNA strands in a single active site. Nat Struct Mol Biol 27:119-126 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.