Transcription Factor

Accessions: 1hry_A (3D-footprint 20241219), 1hrz_A (3D-footprint 20241219)
Names: HUMAN SRY, Sex-determining region Y protein, SRY_HUMAN, Testis-determining factor
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q05066
Length: 73
Pfam Domains: 2-61 Domain of unknown function (DUF1898)
3-71 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 DRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQ 60
61 AMHREKYPNYKYR
Interface Residues: 5, 8, 10, 11, 14, 18, 29, 30, 31, 34, 72
3D-footprint Homologues: 2lef_A, 7m5w_A, 2gzk_A
Binding Motifs: 1hry_A ACAAac
1hrz_A ACAAac
Binding Sites: 1hry_B / 1hrz_B
1hry_C / 1hrz_C
Publications: Werner M. H., Huth J. R., Gronenborn A. M., Clore G. M. Molecular basis of human 46X,Y sex reversal revealed from the three-dimensional solution structure of the human SRY-DNA complex. Cell 81:705-714 (1995). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.