Transcription Factor

Accessions: BSX_DBD (HumanTF 1.0), BSX (HT-SELEX2 May2017)
Names: BSH_HUMAN, BSX, ENSG00000188909
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q3C1V8
Notes: Ensembl ID: ENSG00000188909; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 110
Pfam Domains: 28-84 Homeobox domain
Sequence:
(in bold interface residues)
1 LTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVEL 60
61 ATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAPDGPESPEGSPRGSE
Interface Residues: 27, 28, 29, 30, 31, 69, 70, 72, 73, 76, 77, 80, 81, 84
3D-footprint Homologues: 4j19_B, 1ig7_A, 2h1k_B, 1puf_A, 6a8r_A, 3cmy_A, 3d1n_M, 1fjl_B, 5zfz_A, 3lnq_A, 2lkx_A, 1jgg_B, 1nk2_P, 1zq3_P, 7q3o_C, 6es3_K, 2ld5_A, 5zjt_E, 3a01_E, 7psx_B, 5hod_A, 2hdd_A, 5jlw_D, 3rkq_B, 2r5y_A, 1au7_A, 4xrs_G, 2hos_A, 4cyc_A, 6m3d_C, 1b72_A, 5flv_I, 1e3o_C, 7xrc_C, 2xsd_C, 1le8_A, 1le8_B, 1du0_A, 4qtr_D, 1mnm_C, 1puf_B, 1k61_B, 3l1p_A, 1o4x_A, 8g87_X
Binding Motifs: BSX_DBD symATTAv
BSX_3 syrATTAs
BSX_4 vtCRTTAm
BSX_methyl_1 symATTAs
BSX_methyl_2 vtCrTTAw
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.