Transcription Factor
Accessions: | 5e6b_A (3D-footprint 20241219) |
Names: | GCR_HUMAN, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P04150 |
Length: | 74 |
Pfam Domains: | 3-71 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC 60 61 RYRKCLQAGMNLEA |
Interface Residues: | 14, 16, 23, 26, 27, 30, 31, 55 |
3D-footprint Homologues: | 7wnh_D, 6l6q_B, 3g9m_B, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7xvn_C, 7prw_B, 5cbx_B, 5cbz_E, 3g6t_A, 8rm6_A |
Binding Motifs: | 5e6b_AB CGnnnAATnC 5e6b_A GnATT |
Binding Sites: | 5e6b_C 5e6b_D |
Publications: | Hudson WH, Vera IMS, Nwachukwu JC, Weikum ER, Herbst AG, Yang Q, Bain DL, Nettles KW, Kojetin DJ, Ortlund EA. Cryptic glucocorticoid receptor-binding sites pervade genomic NF-κB response elements. Nat Commun 9:1337 (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.