Transcription Factor
| Accessions: | P61296 (JASPAR 2024) |
| Names: | bHLHa26, Class A basic helix-loop-helix protein 26, Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2, dHAND, HAND2_HUMAN, Heart- and neural crest derivatives-expressed protein 2 |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P61296 |
| Length: | 217 |
| Pfam Domains: | 100-151 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSM 60 61 ALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFA 120 121 ELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEK 180 181 RKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ |
| Interface Residues: | 101, 103, 104, 105, 107, 108, 110, 111, 112, 135, 137 |
| 3D-footprint Homologues: | 2ypa_A, 7z5k_B, 7xi3_B, 1an4_A, 7xhv_B, 4h10_A, 5eyo_A, 1am9_A, 7ssa_L, 5i50_B, 2ql2_D, 7f2f_B, 2ypa_B, 8osl_P, 5gnj_I, 5v0l_B |
| Binding Motifs: | MA1638.1 amCAGATGby MA1638.2 CAGATG |
| Binding Sites: | MA1638.2.1 / MA1638.2.10 / MA1638.2.11 / MA1638.2.12 / MA1638.2.13 / MA1638.2.14 / MA1638.2.15 / MA1638.2.16 / MA1638.2.17 / MA1638.2.18 / MA1638.2.19 / MA1638.2.2 / MA1638.2.20 / MA1638.2.3 / MA1638.2.6 / MA1638.2.8 / MA1638.2.9 MA1638.1.1 MA1638.1.10 / MA1638.1.8 MA1638.1.11 / MA1638.1.9 MA1638.1.10 / MA1638.1.12 MA1638.1.11 / MA1638.1.13 MA1638.1.12 / MA1638.1.14 MA1638.1.13 / MA1638.1.15 MA1638.1.14 / MA1638.1.16 MA1638.1.17 MA1638.1.15 / MA1638.1.18 MA1638.1.16 / MA1638.1.19 MA1638.1.2 MA1638.1.17 / MA1638.1.20 MA1638.1.2 / MA1638.1.3 MA1638.1.3 / MA1638.1.4 MA1638.1.4 / MA1638.1.5 MA1638.1.5 / MA1638.1.6 MA1638.1.7 MA1638.1.6 / MA1638.1.8 MA1638.1.9 MA1638.1.18 MA1638.1.19 MA1638.1.20 MA1638.1.7 MA1638.2.4 / MA1638.2.5 MA1638.2.7 |
| Publications: | Dai Y. S., Cserjesi P. The basic helix-loop-helix factor, HAND2, functions as a transcriptional activator by binding to E-boxes as a heterodimer.. J. Biol. Chem. 277:12604-12612 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.