Transcription Factor

Accessions: T049086_1.02 (CISBP 1.02)
Names: T049086_1.02;, Zfp263
Organisms: Mus musculus
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 392
Pfam Domains: 89-110 C2H2-type zinc finger
91-112 C2H2-type zinc finger
92-112 Zinc finger, C2H2 type
146-168 C2H2-type zinc finger
146-168 Zinc finger, C2H2 type
160-185 Zinc-finger double domain
174-196 C2H2-type zinc finger
174-196 C2H2-type zinc finger
174-196 Zinc finger, C2H2 type
188-213 Zinc-finger double domain
201-222 C2H2-type zinc finger
202-224 C2H2-type zinc finger
202-224 Zinc finger, C2H2 type
216-241 Zinc-finger double domain
230-252 C2H2-type zinc finger
230-241 C2H2-type zinc finger
230-252 Zinc finger, C2H2 type
276-294 Zinc-finger double domain
283-306 C2H2-type zinc finger
284-306 C2H2-type zinc finger
284-306 Zinc finger, C2H2 type
298-323 Zinc-finger double domain
312-334 C2H2-type zinc finger
312-332 C2H2-type zinc finger
312-334 Zinc finger, C2H2 type
326-351 Zinc-finger double domain
339-362 C2H2-type zinc finger
340-362 C2H2-type zinc finger
340-362 Zinc finger, C2H2 type
357-378 Zinc-finger double domain
367-390 C2H2-type zinc finger
368-390 C2H2-type zinc finger
368-390 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MNPRNPVPGVEKFENQERNVESVSPESTHPPVLLPGQARREVPWSPEQGRLDDREGHWEC 60
61 PPEDKIEESLVGTPSCKGLVQAKEQPKKLHLCALCGKNFSNNSNLIRHQRIHAAEKLCMD 120
121 VECGEVFGGHPHFLSLHRTHIGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPFQCNACG 180
181 KSFSCNSNLNRHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYRCSECGKSFS 240
241 RSSHLVIHERTHEKERLDPFPECGQGMNDSAPFLTNHRVEKKLFECSTCGKSFRQGMHLT 300
301 RHQRTHTGEKPYKCILCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLR 360
361 THTGERPYKCSECGESFSRSSRLTSHQRTHTG
Interface Residues: 101, 103, 107, 128, 129, 131, 132, 156, 157, 158, 159, 160, 162, 163, 165, 166, 169, 184, 185, 186, 187, 188, 190, 191, 192, 194, 195, 212, 213, 214, 215, 216, 217, 218, 219, 220, 222, 240, 241, 242, 243, 244, 247, 269, 270, 271, 272, 275, 278, 284, 294, 295, 296, 297, 298, 301, 307, 321, 322, 323, 324, 325, 326, 328, 329, 333, 350, 351, 352, 353, 354, 355, 357, 378, 379, 380, 381, 382, 384, 385
3D-footprint Homologues: 7w1m_H, 1tf6_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 6ml4_A, 5v3j_F, 8ssq_A, 4x9j_A, 8ssu_A, 5kkq_D, 5ei9_F, 1g2f_F, 5kl3_A, 1ubd_C, 8h9h_G, 7ysf_A, 6e94_A, 7y3m_I, 2jpa_A, 1llm_D, 6blw_A, 5k5l_F, 6u9q_A, 4m9v_C, 2lt7_A, 2drp_D, 1f2i_J, 2wbs_A, 8gn3_A, 5yj3_D, 5yel_A, 2kmk_A, 3uk3_C, 5k5i_A, 2gli_A, 6jnm_A, 6a57_A, 7txc_E
Binding Motifs: M0397_1.02 gGGAGsAC
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.