Transcription Factor

Accessions: DUXA (HT-SELEX2 May2017)
Names: DUXA, ENSG00000204527
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 179
Pfam Domains: 14-68 Homeobox domain
35-67 Homeobox KN domain
100-153 Homeobox domain
119-153 Homeobox KN domain
Sequence:
(in bold interface residues)
1 EDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIW 60
61 FQNRRARHGFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAFMK 120
121 NPYPGIDSREELAKEIGVPESRVQIWFQNRRSRLLLQRKREPVASLEQEEQGKIPEGLQ
Interface Residues: 14, 17, 59, 62, 63, 66, 73, 100, 101, 102, 103, 141, 142, 144, 145, 148, 149, 151, 152, 153
3D-footprint Homologues: 5zfz_A, 6m3d_C, 1puf_A, 1fjl_B, 3d1n_M, 8pmf_A, 1ig7_A, 8ejp_B, 6a8r_A, 3cmy_A, 3lnq_A, 1nk2_P, 1zq3_P, 1jgg_B, 2lkx_A, 2ld5_A, 7q3o_C, 4cyc_A, 2r5y_A, 8eml_B, 6es3_K, 4xrs_G, 2hos_A, 1b72_A, 4j19_B, 1puf_B, 5flv_I, 9b8u_A, 5zjt_E, 3a01_E, 8ik5_C, 7psx_B, 5hod_A, 3rkq_B, 2hdd_A, 8osb_E, 1au7_A, 5jlw_D, 1le8_A, 7xrc_C, 2xsd_C, 1e3o_C, 8g87_X, 8bx1_A, 1du0_A, 4qtr_D, 1o4x_A, 4xrm_B, 1k61_B
Binding Motifs: DUXA_2 TrAyyyAATCA
DUXA_methyl_1 trAyyyAATCA
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.