Transcription Factor

Accessions: T037047_1.02 (CISBP 1.02), T22974 (AthalianaCistrome v4_May2016), Q84K31 (JASPAR 2024)
Names: AT5G04390, T037047_1.02;, T22974;, C2H2-type zinc finger family protein, Putative zinc finger transcription factor, Q84K31_ARATH
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, AthalianaCistrome v4_May2016 2, JASPAR 2024 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF, ecotype:Col-0, experiment type: DAP-seq, family:C2H2
Length: 362
Pfam Domains: 152-177 C2H2-type zinc finger
228-253 C2H2-type zinc finger
229-251 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MEAFEEATKEQSLILKGKRTKRQRPQSPIPFSISPPIVSTPENNMEEEYTDLDSKDNALG 60
61 NDEGNHKKDGVITSSSSSASWSSQNNHTLKAAEDEEDQDIANCLILLAQGHSLPHNNHHL 120
121 PNSNNNNTYRFTSRRFLETSSSNSGGKAGYYVYQCKTCDRTFPSFQALGGHRASHKKPKA 180
181 ASFYSNLDLKKNTYANDAVSLVHTTTTVFKNNNSRSLVVYGKASKNKVHECGICGAEFTS 240
241 GQALGGHMRRHRGAVVVPAVIAPTVTVATAAANTELSLSSMSFDQISDGHQDHLAMPAKK 300
301 KARTVVSLDLDLNLPAPEDENRVNGFSFASKQNHEQEHQQKKQREEPKSLVLSAPTLVDC 360
361 HY
Interface Residues: 153, 164, 165, 166, 167, 170, 176, 184, 185, 187, 188, 191, 211, 213, 215, 216, 219, 223, 239, 240, 241, 242, 243, 244, 246, 276, 277
3D-footprint Homologues: 2kmk_A, 8ssu_A, 5kkq_D, 5v3j_F, 7w1m_H, 8ssq_A, 5yel_A, 3uk3_C, 6ml4_A, 7y3l_A, 7n5w_A, 8h9h_G, 7txc_E
Binding Motifs: M0375_1.02 rasTrwa
M0308 dAGTGwwrkwr
MA1736.1 ywmywwCACTh
MA1736.2 wCACT
Publications: O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.