Transcription Factor
| Accessions: | POU3F1_DBD (HumanTF 1.0), POU3F1 (HT-SELEX2 May2017) |
| Names: | Oct-6, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF-6, PO3F1_HUMAN, POU domain transcription factor SCIP, POU domain, class 3, transcription factor 1, POU3F1, ENSG00000185668 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q03052 |
| Notes: | Ensembl ID: ENSG00000185668; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Gene synthesis, TF family: POU experiment: HT-SELEX Hamming distance: 1 cycle: 4b0, TF family: POU experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 201 |
| Pfam Domains: | 20-93 Pou domain - N-terminal to homeobox domain 112-168 Homeobox domain |
| Sequence: (in bold interface residues) | 1 HLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVF 60 61 SQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEV 120 121 GVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPM 180 181 DDVYAPGELGPGGGGASPPSA |
| Interface Residues: | 45, 61, 62, 63, 64, 66, 67, 73, 77, 110, 112, 113, 114, 115, 153, 154, 156, 157, 160, 161, 164, 165, 168 |
| 3D-footprint Homologues: | 3d1n_M, 3l1p_A, 7u0g_M, 7xrc_C, 1au7_A, 1o4x_A, 8g87_X, 2xsd_C, 1e3o_C, 3lnq_A, 5zfz_A, 1fjl_B, 1puf_A, 1ig7_A, 6a8r_A, 3cmy_A, 2h1k_B, 1zq3_P, 1jgg_B, 2lkx_A, 1nk2_P, 3rkq_B, 2r5y_A, 7psx_B, 5hod_A, 3a01_E, 4xrs_G, 2ld5_A, 5jlw_D, 1le8_A, 7q3o_C, 1k61_B, 5flv_I, 2hdd_A, 1b72_A, 5zjt_E, 4cyc_A, 1mnm_C, 1du0_A, 4qtr_D, 6es3_K |
| Binding Motifs: | POU3F1_DBD_1 wTATGywAATkw POU3F1_DBD_2 wTGmATAAwtwA POU3F1_6 wtATGcwAATkag POU3F1_7 mTaATkwAtgcrh POU3F1_8 mTAATgakaTGCrb POU3F1_9 yAATTrrcssyyAATTr POU3F1_methyl_1 wTATGCwAATkAG POU3F1_methyl_2 wTAATTTATGCGy POU3F1_methyl_3 wTAATGAkATGCGy POU3F1_methyl_4 wtATGCGCATah POU3F1_methyl_5 TAATkwyvmsytmaTkA |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.