Transcription Factor

Accessions: POU3F1_DBD (HumanTF 1.0), POU3F1 (HT-SELEX2 May2017)
Names: Oct-6, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF-6, PO3F1_HUMAN, POU domain transcription factor SCIP, POU domain, class 3, transcription factor 1, POU3F1, ENSG00000185668
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q03052
Notes: Ensembl ID: ENSG00000185668; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Gene synthesis, TF family: POU experiment: HT-SELEX Hamming distance: 1 cycle: 4b0, TF family: POU experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 201
Pfam Domains: 20-93 Pou domain - N-terminal to homeobox domain
112-168 Homeobox domain
Sequence:
(in bold interface residues)
1 HLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVF 60
61 SQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEV 120
121 GVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPM 180
181 DDVYAPGELGPGGGGASPPSA
Interface Residues: 45, 61, 62, 63, 64, 66, 67, 73, 77, 110, 112, 113, 114, 115, 153, 154, 156, 157, 160, 161, 163, 164, 165, 168
3D-footprint Homologues: 3d1n_M, 7u0g_M, 8bx1_A, 1e3o_C, 1au7_A, 2xsd_C, 1o4x_A, 7xrc_C, 8g87_X, 3lnq_A, 8ejp_B, 6a8r_A, 8osb_E, 1fjl_B, 1puf_A, 8pmf_A, 1ig7_A, 5zfz_A, 3cmy_A, 2lkx_A, 1zq3_P, 1jgg_B, 1nk2_P, 5hod_A, 4xrs_G, 3a01_E, 3rkq_B, 7psx_B, 9b8u_A, 2r5y_A, 8ik5_C, 5jlw_D, 2ld5_A, 7q3o_C, 1le8_A, 2hdd_A, 1k61_B, 4qtr_D, 8eml_B, 1b72_A, 6es3_K, 1mnm_C, 1du0_A, 5flv_I, 5zjt_E, 4cyc_A
Binding Motifs: POU3F1_DBD_1 wTATGywAATkw
POU3F1_DBD_2 wTGmATAAwtwA
POU3F1_6 wtATGcwAATkag
POU3F1_7 mTaATkwAtgcrh
POU3F1_8 mTAATgakaTGCrb
POU3F1_9 yAATTrrcssyyAATTr
POU3F1_methyl_1 wTATGCwAATkAG
POU3F1_methyl_2 wTAATTTATGCGy
POU3F1_methyl_3 wTAATGAkATGCGy
POU3F1_methyl_4 wtATGCGCATah
POU3F1_methyl_5 TAATkwyvmsytmaTkA
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.