Transcription Factor

Accessions: T061559_1.02 (CISBP 1.02), Q00453 (JASPAR 2024)
Names: RGM1, T061559_1.02;, RGM1_YEAST
Organisms: Saccharomyces cerevisiae
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 211
Pfam Domains: 19-44 C2H2-type zinc finger
19-44 Zinc finger, C2H2 type
36-60 Zinc-finger double domain
50-73 C2H2-type zinc finger
50-73 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MRGKQPKRNKDNASVKRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFS 60
61 RIDNLRQHQSSVHSDVDLMSLRRLQQSANSTANDPNATRMFPQLRPYGIVVQPAPVPYNL 120
121 PISTPASPQDTISLYAPPYFPHPMPSAPIPLPHQPPPLPIYSYMQPLFLNHTPIQNHNIV 180
181 ELPPDSSDTPASPSKVQSFDQAKDASPNAKK
Interface Residues: 2, 4, 5, 8, 17, 32, 33, 34, 35, 36, 38, 39, 40, 41, 42, 45, 60, 61, 62, 63, 64, 65, 66, 67, 68, 90, 91, 92, 93, 193, 194, 196, 197
3D-footprint Homologues: 7ysf_A, 1ubd_C, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 2kmk_A, 3uk3_C, 7w1m_H, 6blw_A, 5k5i_A, 2lt7_A, 6u9q_A, 5yel_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 2wbs_A, 1tf6_A, 8gn3_A, 4x9j_A, 1g2f_F, 6jnm_A, 5kl3_A, 7txc_E, 6a57_A, 5ei9_F, 1llm_D, 6ml4_A, 5v3j_F, 2drp_D, 8ssq_A, 4m9v_C, 8h9h_G, 7y3m_I, 2jpa_A, 6e94_A, 5yj3_D, 3q5f_A
Binding Motifs: M0534_1.02 yCAGGGGc
MA0366.1 AGGGG
Publications: Badis G, Chan E.T, van Bakel H, Pena-Castillo L, Tillo D, Tsui K, Carlson C.D, Gossett A.J, Hasinoff M.J, Warren C.L, Gebbia M, Talukder S, Yang A, Mnaimneh S, Terterov D, Coburn D, Li Yeo A, Yeo Z.X, Clarke N.D, Lieb J.D, Ansari A.Z, Nislow C, Hughes T.R. A library of yeast transcription factor motifs reveals a widespread function for Rsc3 in targeting nucleosome exclusion at promoters. Molecular cell 32:878-87 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.