Transcription Factor
| Accessions: | YAB5 (ArabidopsisPBM 20140210), T143200_1.02 (CISBP 1.02), Q8GW46 (JASPAR 2024) |
| Names: | YAB5, T143200_1.02;, YAB5_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | ArabidopsisPBM 20140210 1, CISBP 1.02 2, JASPAR 2024 3 1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | Zn finger (C2C2-YABBY), experiment type:PBM, family:Sox |
| Length: | 164 |
| Pfam Domains: | 5-62 YABBY protein 71-153 YABBY protein |
| Sequence: (in bold interface residues) | 1 MANSVMATEQLCYIPCNFCNIILAVNVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSR 60 61 PNFQATNYAVPEYGSSSRSHTKIPSRISTRTITEQRIVNRPPEKRQRVPSAYNQFIKEEI 120 121 QRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESNKQAKIA |
| Interface Residues: | 110, 112, 113, 116, 120, 131, 132, 133, 136 |
| 3D-footprint Homologues: | 3f27_D, 3tmm_A |
| Binding Motifs: | YAB5 waATgAtTAh M1576_1.02 twawyrd UN0416.1 rATaATTAwhsa UN0416.2 ATaATTAw |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.