Transcription Factor
| Accessions: | 2gzk_A (3D-footprint 20231221) |
| Names: | Amphoterin, Heparin-binding protein p30, High mobility group protein 1, High mobility group protein B1, HMG-1, HMGB1_RAT, Sex-determining region on Y / HMGB1 |
| Organisms: | Rattus norvegicus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 159 |
| Pfam Domains: | 4-63 Domain of unknown function (DUF1898) 5-73 HMG (high mobility group) box 86-152 Domain of unknown function (DUF1898) 89-157 HMG (high mobility group) box |
| Sequence: (in bold interface residues) | 1 VQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQK 60 61 LQAMHREKYPNYKYRKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVA 120 121 KKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK |
| Interface Residues: | 7, 10, 12, 13, 16, 20, 31, 32, 33, 36, 74, 75, 76, 78, 81, 82, 91, 94, 96, 97, 100, 104, 112, 113, 116, 117, 120 |
| 3D-footprint Homologues: | 3f27_D, 4s2q_D, 3tmm_A, 4y60_C, 2gzk_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 7m5w_A, 1hry_A, 3tq6_B, 1qrv_A, 1j5n_A, 1ckt_A, 7zie_A |
| Binding Motifs: | 2gzk_A GgGATCnnAACAAcGC |
| Binding Sites: | 2gzk_B 2gzk_C |
| Publications: | Stott K, Tang G.S, Lee K.B, Thomas J.O. Structure of a complex of tandem HMG boxes and DNA. Journal of molecular biology 360:90-104 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.