Transcription Factor

						

			
Accessions: 4oln_B (3D-footprint 20231221)

			
Names: AncSR1
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 67
Pfam Domains:      3-67 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 KRLCQVCGDHASGFHYGVWSCEGCKAFFKRSIQDYVCPATNNCTIDKHRRKSCQACRLRK   60
  61 CLEVGMT
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 51
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B
Binding Motifs: 4oln_AB GGTCannntGACC
4oln_B gGTCa
Binding Sites: 4oln_E
4oln_F
			
Publications: McKeown A.N, Bridgham J.T, Anderson D.W, Murphy M.N, Ortlund E.A, Thornton J.W. Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module. Cell 159:58-68 (2014). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.