Transcription Factor
Accessions: | 3a5t_B (3D-footprint 20231221) |
Names: | MAFG_MOUSE, Transcription factor MafG, V-maf musculoaponeurotic fibrosarcoma oncogene homolog G |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | O54790 |
Length: | 93 |
Pfam Domains: | 4-93 bZIP Maf transcription factor |
Sequence: (in bold interface residues) | 1 MGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEEL 60 61 EKQKAELQQEVEKLASENASMKLELDALRSKYE |
Interface Residues: | 38, 42, 45, 46, 49, 50 |
3D-footprint Homologues: | 7x5e_E, 2wt7_A, 7x5e_F, 2wt7_B, 4eot_A |
Binding Motifs: | 3a5t_AB TGAtAAGTTaGCA 3a5t_B tGCtkact |
Binding Sites: | 3a5t_C 3a5t_D |
Publications: | Kurokawa H, Motohashi H, Sueno S, Kimura M, Takagawa H, Kanno Y, Yamamoto M, Tanaka T. Structural basis of alternative DNA recognition by Maf transcription factors. Molecular and cellular biology 29:6232-44 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.