Transcription Factor

Accessions: sens (FlyZincFinger 1.0 )
Names: CG32120
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 124
Pfam Domains: 14-36 C2H2-type zinc finger
14-36 Zinc finger, C2H2 type
14-32 C2H2-type zinc finger
29-52 Zinc-finger double domain
42-60 C2H2-type zinc finger
42-64 Zinc finger, C2H2 type
42-52 C2H2-type zinc finger
57-80 Zinc-finger double domain
69-92 C2H2-type zinc finger
70-92 C2H2-type zinc finger
70-92 Zinc finger, C2H2 type
84-107 Zinc-finger double domain
98-121 C2H2-type zinc finger
99-121 Zinc finger, C2H2 type
100-121 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 YQGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKH 60
61 TYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESR 120
121 HEEA
Interface Residues: 14, 25, 26, 27, 28, 30, 31, 32, 33, 34, 35, 37, 52, 53, 54, 55, 56, 57, 59, 60, 63, 67, 80, 81, 82, 83, 84, 86, 87, 91, 108, 109, 110, 111, 112, 113, 114, 115
3D-footprint Homologues: 2kmk_A, 5v3j_F, 2drp_D, 1tf6_A, 8ssq_A, 7w1m_H, 5kkq_D, 5yel_A, 5ei9_F, 8ssu_A, 8gn3_A, 5k5i_A, 4m9v_C, 2lt7_A, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 1tf3_A, 6jnm_A, 7y3l_A, 3uk3_C, 7n5w_A, 1f2i_J, 7txc_E, 5k5l_F, 6ml4_A, 4x9j_A, 2gli_A, 1g2f_F, 6blw_A, 2wbs_A, 6u9q_A, 5kl3_A, 8h9h_G, 6a57_A, 5w7g_H, 1yuj_A, 8cuc_F, 1llm_D, 7y3m_I, 5yj3_D
Binding Motifs: sens_SANGER_10_FBgn0002573 GCyGTGATTT
sens_SOLEXA_5_FBgn0002573 kGCyGTGATTTrbkk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.