Transcription Factor

						

			
Accessions: sens (FlyZincFinger 1.0 )

			
Names: CG32120
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 124
Pfam Domains:     14-36 C2H2-type zinc finger
    14-36 Zinc finger, C2H2 type
    14-32 C2H2-type zinc finger
    29-52 Zinc-finger double domain
    42-60 C2H2-type zinc finger
    42-64 Zinc finger, C2H2 type
    42-52 C2H2-type zinc finger
    57-80 Zinc-finger double domain
    69-92 C2H2-type zinc finger
    70-92 C2H2-type zinc finger
    70-92 Zinc finger, C2H2 type
   84-107 Zinc-finger double domain
   98-121 C2H2-type zinc finger
   99-121 Zinc finger, C2H2 type
  100-121 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 YQGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKH   60
  61 TYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESR  120
 121 HEEA
Interface Residues: 14, 25, 26, 27, 28, 30, 31, 32, 33, 34, 35, 37, 52, 53, 54, 55, 56, 57, 59, 60, 63, 67, 80, 81, 82, 83, 84, 86, 87, 91, 108, 109, 110, 111, 112, 113, 114, 115
3D-footprint Homologues: 2kmk_A, 8ssq_A, 7w1m_H, 5v3j_F, 5kkq_D, 8ssu_A, 5ei9_F, 8gn3_A, 2drp_D, 5yel_A, 5k5i_A, 1tf6_A, 5und_A, 6wmi_A, 7eyi_G, 4m9v_C, 2lt7_A, 2i13_A, 6e94_A, 7ysf_A, 2jpa_A, 1ubd_C, 6jnm_A, 7y3l_A, 1tf3_A, 7n5w_A, 3uk3_C, 5k5l_F, 4x9j_A, 1mey_C, 2wbs_A, 1f2i_J, 6ml4_A, 6blw_A, 5kl3_A, 1g2f_F, 6u9q_A, 7txc_E, 2gli_A, 8h9h_G, 6a57_A, 5w7g_H, 1yuj_A, 8cuc_F, 1llm_D, 7y3m_I, 5yj3_D
Binding Motifs: sens_SANGER_10_FBgn0002573 GCyGTGATTT
sens_SOLEXA_5_FBgn0002573 kGCyGTGATTTrbkk
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.