Transcription Factor
| Accessions: | sens (FlyZincFinger 1.0 ) |
| Names: | CG32120 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 124 |
| Pfam Domains: | 14-36 C2H2-type zinc finger 14-36 Zinc finger, C2H2 type 14-32 C2H2-type zinc finger 29-52 Zinc-finger double domain 42-60 C2H2-type zinc finger 42-64 Zinc finger, C2H2 type 42-52 C2H2-type zinc finger 57-80 Zinc-finger double domain 69-92 C2H2-type zinc finger 70-92 C2H2-type zinc finger 70-92 Zinc finger, C2H2 type 84-107 Zinc-finger double domain 98-121 C2H2-type zinc finger 99-121 Zinc finger, C2H2 type 100-121 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 YQGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKH 60 61 TYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESR 120 121 HEEA |
| Interface Residues: | 14, 25, 26, 27, 28, 30, 31, 32, 33, 34, 35, 37, 52, 53, 54, 55, 56, 57, 59, 60, 63, 67, 80, 81, 82, 83, 84, 86, 87, 91, 108, 109, 110, 111, 112, 113, 114, 115 |
| 3D-footprint Homologues: | 2kmk_A, 5v3j_F, 2drp_D, 1tf6_A, 8ssq_A, 7w1m_H, 5kkq_D, 5yel_A, 5ei9_F, 8ssu_A, 8gn3_A, 5k5i_A, 4m9v_C, 2lt7_A, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 1tf3_A, 6jnm_A, 7y3l_A, 3uk3_C, 7n5w_A, 1f2i_J, 7txc_E, 5k5l_F, 6ml4_A, 4x9j_A, 2gli_A, 1g2f_F, 6blw_A, 2wbs_A, 6u9q_A, 5kl3_A, 8h9h_G, 6a57_A, 5w7g_H, 1yuj_A, 8cuc_F, 1llm_D, 7y3m_I, 5yj3_D |
| Binding Motifs: | sens_SANGER_10_FBgn0002573 GCyGTGATTT sens_SOLEXA_5_FBgn0002573 kGCyGTGATTTrbkk |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.