Transcription Factor

						

			
Accessions: 2wbu_A (3D-footprint 20231221), 4m9e_A (3D-footprint 20231221), 5ke6_A (3D-footprint 20231221)

			
Names: Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor, KLF4_MOUSE, KRUEPPEL-LIKE FACTOR 4
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q60793
Length: 85
Pfam Domains:      2-26 C2H2-type zinc finger
     2-26 Zinc finger, C2H2 type
    18-40 Zinc-finger double domain
    32-56 Zinc finger, C2H2 type
    32-56 C2H2-type zinc finger
    49-73 Zinc-finger double domain
    62-84 Zinc finger, C2H2 type
    62-84 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHR   60
  61 PFQCQKCDRAFSRSDHLALHMKRHF
Interface Residues: 14, 15, 16, 17, 18, 20, 21, 23, 24, 27, 44, 45, 46, 47, 48, 50, 51, 52, 55, 65, 66, 68, 69, 72, 73, 74, 75, 76, 77, 78, 79, 80, 83
3D-footprint Homologues: 8cuc_F, 1tf3_A, 3uk3_C, 6ml4_A, 7n5w_A, 6jnm_A, 2kmk_A, 7eyi_G, 8ssq_A, 2gli_A, 1g2f_F, 1tf6_A, 6blw_A, 5kkq_D, 8ssu_A, 2i13_A, 1llm_D, 6u9q_A, 1ubd_C, 5kl3_A, 7ysf_A, 1mey_C, 6wmi_A, 5ei9_F, 7w1m_H, 5und_A, 5v3j_F, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 5k5i_A, 7y3l_A, 5yel_A, 4x9j_A, 8gn3_A, 7txc_E, 2wbs_A, 2drp_D, 1f2i_J, 4m9v_C, 2stt_A, 4bqa_A, 4l18_B, 4lg0_B, 5yj3_D, 8gh6_A
Binding Motifs: 2wbu_A GGGGCGTGGc
4m9e_A GAGGnnTGGC
5ke6_A gAGGTGTGgC
Binding Sites: 2wbu_B
2wbu_C
5ke6_B
5ke6_C
4m9e_B
4m9e_C
			
Publications: Schuetz A, Nana D, Rose C, Zocher G, Milanovic M, Koenigsmann J, Blasig R, Heinemann U, Carstanjen D. The structure of the Klf4 DNA-binding domain links to self-renewal and macrophage differentiation. Cellular and molecular life sciences : CMLS 68:3121-31 (2011). [Pubmed]


Liu Y, Olanrewaju Y.O, Zheng Y, Hashimoto H, Blumenthal R.M, Zhang X, Cheng X. Structural basis for Klf4 recognition of methylated DNA. Nucleic acids research 42:4859-67 (2014). [Pubmed]


Hashimoto H, Wang D, Steves AN, Jin P, Blumenthal RM, Zhang X, Cheng X. Distinctive Klf4 mutants determine preference for DNA methylation status. Nucleic Acids Res 44:10177-10185 (2016). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.