Transcription Factor
Accessions: | POU4F3 (HT-SELEX2 May2017) |
Names: | ENSG00000091010, POU4F3 |
Organisms: | Homo sapiens |
Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Notes: | TF family: POU experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: POU experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
Length: | 178 |
Pfam Domains: | 21-96 Pou domain - N-terminal to homeobox domain 115-171 Homeobox domain |
Sequence: (in bold interface residues) | 1 MSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGV 60 61 GSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTS 120 121 IAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH |
Interface Residues: | 45, 46, 64, 65, 66, 67, 69, 70, 76, 80, 115, 116, 117, 118, 156, 157, 159, 160, 163, 164, 167, 168, 171 |
3D-footprint Homologues: | 7u0g_M, 3d1n_M, 3l1p_A, 3cro_R, 1au7_A, 7xrc_C, 1o4x_A, 8g87_X, 1e3o_C, 2xsd_C, 1fjl_B, 3cmy_A, 5zfz_A, 1puf_A, 2h1k_B, 1nk2_P, 1zq3_P, 2lkx_A, 1jgg_B, 3lnq_A, 2ld5_A, 5hod_A, 3a01_E, 1ig7_A, 1b72_A, 7psx_B, 2d5v_B, 2r5y_A, 5zjt_E, 3rkq_B, 1puf_B, 5jlw_D, 7q3o_C, 1le8_A, 6es3_K, 4qtr_D, 4xrs_G, 5flv_I |
Binding Motifs: | POU4F3_3 aTtmATwATGCAt POU4F3_4 aTgmATwATgcAt POU4F3_7 aTrMATwATKCAT POU4F3_8 aTrmATwATkyAt POU4F3_methyl_1 aTyAATwATKCAt POU4F3_methyl_2 tyATGCATra POU4F3_methyl_5 aTrAATwATkcAt POU4F3_methyl_6 aTrmATwATkyAt |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.