Transcription Factor

Accessions: NHLH1_full (HumanTF 1.0)
Names: cDNA, FLJ94293, Homo sapiens nescient helix loop helix 1 (NHLH1, Nescient helix loop helix 1, NHLH1, Q5T203_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q5T203
Notes: Ensembl ID: ENSG00000171786; Full protein sequence; TF family: bHLH; Clone source: hORFeome
Length: 134
Pfam Domains: 77-127 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH 60
61 LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA 120
121 ICYISYLNHVLDV*
Interface Residues: 77, 80, 81, 83, 84, 85, 87, 88
3D-footprint Homologues: 2ypa_A, 7z5k_B, 8osb_B, 6od3_F, 1am9_A, 4h10_A, 8osl_P, 2ypa_B, 2ql2_A, 2ql2_D
Binding Motifs: NHLH1_full cGCAGCTGCk
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.