Transcription Factor

						

			
Accessions: 1a1i_A (3D-footprint 20231221), 1a1k_A (3D-footprint 20231221)

			
Names: Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, RADR ZIF268 ZINC FINGER PEPTIDE, Transcription factor Zif268, Zinc finger protein Krox-24, RADR ZIF268 VARIANT
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08046
Length: 85
Pfam Domains:      3-27 C2H2-type zinc finger
     3-27 Zinc finger, C2H2 type
    19-43 Zinc-finger double domain
    33-55 C2H2-type zinc finger
    33-55 Zinc finger, C2H2 type
    47-71 Zinc-finger double domain
    61-79 C2H2-type zinc finger
    61-83 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 RPYACPVESCDRRFSRSADLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKP   60
  61 FACDICGRKFARSDERKRHTKIHLR
Interface Residues: 15, 16, 17, 18, 19, 21, 22, 41, 43, 44, 45, 46, 47, 49, 50, 51, 71, 72, 73, 74, 75, 76, 77, 78, 79
3D-footprint Homologues: 7n5w_A, 1tf3_A, 6jnm_A, 4x9j_A, 2i13_A, 6blw_A, 5kkq_D, 1ubd_C, 6u9q_A, 5ei9_F, 2jpa_A, 1mey_C, 5kl3_A, 7ysf_A, 1f2i_J, 6wmi_A, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 5k5l_F, 8ssu_A, 1tf6_A, 6ml4_A, 5v3j_F, 8h9h_G, 7eyi_G, 6e94_A, 2lt7_A, 6a57_A, 2drp_D, 3uk3_C, 8cuc_F, 7y3l_A, 1llm_D, 2wbs_A, 5yel_A, 7txc_E, 5k5i_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: 1a1i_A GCGTGGGC
1a1k_A GCGTGGGm
Binding Sites: 1a1k_B
1a1k_C
1a1i_B
1a1i_C
			
Publications: Elrod-Erickson M, Benson T.E, Pabo C.O. High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition. Structure (London, England : 1993) 6:451-64 (1998). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.