Transcription Factor

Accessions: 1r4o_A (3D-footprint 20250804), 1r4o_B (3D-footprint 20250804)
Names: GCR_RAT, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06536
Length: 80
Pfam Domains: 6-73 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 MKPARPCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCP 60
61 ACRYRKCLQAGMNLEARKTK
Interface Residues: 14, 15, 16, 18, 19, 25, 26, 28, 29, 32, 33, 57
3D-footprint Homologues: 6gys_C, 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 4umm_E, 3cbb_A, 7xv6_B, 4iqr_B, 2han_A, 1hcq_E, 7xvn_C, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8cef_H, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 8hbm_B, 5emc_A, 8rm6_A, 5cbx_B, 3g6t_A, 1r4i_A, 7prw_B, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B
Binding Motifs: 1r4o_AB TGtnc
Binding Sites: 1r4o_C / 1r4o_D
Publications: Luisi B. F., Xu W. X., Otwinowski Z., Freedman L. P., Yamamoto K. R., Sigler P. B. Crystallographic analysis of the interaction of the glucocorticoid receptor with DNA. Nature 352:497-505 (1991). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.