Transcription Factor

Accessions: odd (FlyZincFinger 1.0 )
Names: CG3851
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 118
Pfam Domains: 8-25 C2H2-type zinc finger
8-30 Zinc finger, C2H2 type
8-30 C2H2-type zinc finger
22-46 Zinc-finger double domain
36-58 Zinc finger, C2H2 type
36-58 C2H2-type zinc finger
36-55 C2H2-type zinc finger
50-73 Zinc-finger double domain
64-86 Zinc finger, C2H2 type
64-86 C2H2-type zinc finger
64-75 C2H2-type zinc finger
80-102 Zinc-finger double domain
91-114 C2H2-type zinc finger
92-114 Zinc finger, C2H2 type
92-114 C2H2-type zinc finger
93-114 Zinc-finger of C2H2 type
Sequence:
(in bold interface residues)
1 SSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSK 60
61 DKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQS
Interface Residues: 8, 18, 19, 20, 21, 22, 24, 25, 26, 27, 28, 31, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 57, 62, 63, 74, 75, 76, 77, 78, 79, 80, 81, 84, 89, 91, 92, 98, 99, 102, 103, 104, 105, 106, 108, 109
3D-footprint Homologues: 2kmk_A, 8cuc_F, 3uk3_C, 7y3l_A, 7n5w_A, 6jnm_A, 5v3j_F, 5ei9_F, 5und_A, 8ssq_A, 2drp_D, 1g2f_F, 5k5i_A, 1tf6_A, 8ssu_A, 2gli_A, 1llm_D, 6blw_A, 5kkq_D, 6ml4_A, 4x9j_A, 2i13_A, 1mey_C, 5kl3_A, 7w1m_H, 7eyi_G, 4m9v_C, 8h9h_G, 8gh6_A, 7y3m_I, 6wmi_A, 7ysf_A, 6e94_A, 6a57_A, 2jpa_A, 1ubd_C, 1tf3_A, 5yj3_D, 8gn3_A, 5yel_A, 2wbs_A, 1f2i_J, 6u9q_A, 2lt7_A, 7edb_A, 7txc_E, 6fl1_A, 1yuj_A, 6voy_C
Binding Motifs: odd_NAR_FBgn0002985 mmCAGTAGCAv
odd_NBT_1.5_FBgn0002985 GCTWCyGkw
odd_NBT_2.5_FBgn0002985 GCTACyGkd
odd_NBT_5_FBgn0002985 GCTACTGKw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.