Transcription Factor
Accessions: | odd (FlyZincFinger 1.0 ) |
Names: | CG3851 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 118 |
Pfam Domains: | 8-25 C2H2-type zinc finger 8-30 Zinc finger, C2H2 type 8-30 C2H2-type zinc finger 22-46 Zinc-finger double domain 36-58 Zinc finger, C2H2 type 36-58 C2H2-type zinc finger 36-55 C2H2-type zinc finger 50-73 Zinc-finger double domain 64-86 Zinc finger, C2H2 type 64-86 C2H2-type zinc finger 64-75 C2H2-type zinc finger 80-102 Zinc-finger double domain 91-114 C2H2-type zinc finger 92-114 Zinc finger, C2H2 type 92-114 C2H2-type zinc finger 93-114 Zinc-finger of C2H2 type |
Sequence: (in bold interface residues) | 1 SSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSK 60 61 DKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQS |
Interface Residues: | 8, 18, 19, 20, 21, 22, 24, 25, 26, 27, 28, 31, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 57, 62, 63, 74, 75, 76, 77, 78, 79, 80, 81, 84, 89, 91, 92, 98, 99, 102, 103, 104, 105, 106, 108, 109 |
3D-footprint Homologues: | 2kmk_A, 8cuc_F, 3uk3_C, 7y3l_A, 7n5w_A, 6jnm_A, 5v3j_F, 5ei9_F, 5und_A, 8ssq_A, 2drp_D, 1g2f_F, 5k5i_A, 1tf6_A, 8ssu_A, 2gli_A, 1llm_D, 6blw_A, 5kkq_D, 6ml4_A, 4x9j_A, 2i13_A, 1mey_C, 5kl3_A, 7w1m_H, 7eyi_G, 4m9v_C, 8h9h_G, 8gh6_A, 7y3m_I, 6wmi_A, 7ysf_A, 6e94_A, 6a57_A, 2jpa_A, 1ubd_C, 1tf3_A, 5yj3_D, 8gn3_A, 5yel_A, 2wbs_A, 1f2i_J, 6u9q_A, 2lt7_A, 7edb_A, 7txc_E, 6fl1_A, 1yuj_A, 6voy_C |
Binding Motifs: | odd_NAR_FBgn0002985 mmCAGTAGCAv odd_NBT_1.5_FBgn0002985 GCTWCyGkw odd_NBT_2.5_FBgn0002985 GCTACyGkd odd_NBT_5_FBgn0002985 GCTACTGKw |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.