Transcription Factor
| Accessions: | 5und_B (3D-footprint 20231221) |
| Names: | 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P49711 |
| Length: | 145 |
| Pfam Domains: | 4-26 C2H2-type zinc-finger domain 4-26 C2H2-type zinc finger 19-40 Zinc-finger double domain 32-55 C2H2-type zinc-finger domain 32-54 C2H2-type zinc finger 32-54 Zinc finger, C2H2 type 47-71 Zinc-finger double domain 60-83 C2H2-type zinc finger 90-113 Zinc finger, C2H2 type 90-113 C2H2-type zinc finger 121-142 C2H2-type zinc finger 121-142 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 EKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPY 60 61 ECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGK 120 121 KCRYCDAVFHERYALIQHQKSHKNE |
| Interface Residues: | 4, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 27, 42, 43, 44, 45, 46, 47, 48, 49, 50, 57, 70, 71, 72, 73, 74, 76, 77, 81, 101, 102, 103, 104, 107, 110, 131, 132, 133, 134, 137, 143 |
| 3D-footprint Homologues: | 2kmk_A, 1tf3_A, 7y3l_A, 5v3j_F, 7n5w_A, 5ei9_F, 5kl3_A, 7ysf_A, 1g2f_F, 6wmi_A, 8ssq_A, 1tf6_A, 7w1m_H, 5und_A, 2gli_A, 8ssu_A, 1ubd_C, 6ml4_A, 4x9j_A, 1mey_C, 6blw_A, 5kkq_D, 1f2i_J, 6u9q_A, 8h9h_G, 4m9v_C, 7eyi_G, 6e94_A, 2lt7_A, 2i13_A, 2jpa_A, 3uk3_C, 8cuc_F, 7txc_E, 5yj3_D, 5k5i_A, 6jnm_A, 1llm_D, 6a57_A, 8gn3_A, 2wbs_A, 7y3m_I, 1yuj_A, 2drp_D, 5yel_A, 5k5l_F |
| Binding Motifs: | 5und_AB CCAGCAGGGGGCGcGcCCCCTGCTG |
| Binding Sites: | 5und_C 5und_D 5und_E 5und_F |
| Publications: | Hashimoto H, Wang D, Horton JR, Zhang X, Corces VG, Cheng X. Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Mol Cell 66:711-720 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.