Transcription Factor
| Accessions: | T23730 (AthalianaCistrome v4_May2016), Q9FML4 (JASPAR 2024) |
| Names: | AT5G63090, LOB, T23730;, AS2-like protein 4, ASYMMETRIC LEAVES 2-like protein 4, LOB_ARATH, Protein LATERAL ORGAN BOUNDARIES |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: DAP-seq, family:LOB-AS2 |
| Length: | 186 |
| Pfam Domains: | 11-109 Protein of unknown function DUF260 |
| Sequence: (in bold interface residues) | 1 MASSSNSYNSPCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELL 60 61 PHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRLQKELDAANADLAHYGLSTSA 120 121 AGAPGNVVDLVFQPQPLPSQQLPPLNPVYRLSGASPVMNQMPRGTGGSYGTFLPWNNGHD 180 181 QQGGNM |
| Interface Residues: | 106, 150 |
| 3D-footprint Homologues: | 6ppr_B, 5z7d_C |
| Binding Motifs: | M0473 tCCkCCGccdyckCCGCCGcm MA2022.1 CCGCCGCCGCmgcygcc MA2022.2 CCGCCGCCGCmgc |
| Binding Sites: | MA2022.2.16 / MA2022.2.17 / MA2022.2.5 MA2022.1.1 MA2022.1.10 MA2022.1.11 MA2022.1.12 MA2022.1.13 MA2022.1.14 MA2022.1.15 MA2022.1.16 MA2022.1.17 MA2022.1.18 MA2022.1.19 MA2022.1.2 MA2022.1.20 MA2022.1.3 MA2022.1.4 MA2022.1.5 MA2022.1.6 MA2022.1.7 MA2022.1.8 MA2022.1.9 MA2022.2.1 MA2022.2.10 MA2022.2.11 MA2022.2.12 MA2022.2.13 MA2022.2.14 MA2022.2.15 MA2022.2.18 MA2022.2.19 MA2022.2.2 MA2022.2.20 MA2022.2.3 MA2022.2.4 MA2022.2.6 MA2022.2.7 MA2022.2.8 MA2022.2.9 |
| Publications: | Husbands A, Bell EM, Shuai B, Smith HM, Springer PS. LATERAL ORGAN BOUNDARIES defines a new family of DNA-binding transcription factors and can interact with specific bHLH proteins. Nucleic Acids Res : (2007;35(19):6663-71.). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.