Transcription Factor
Accessions: | 5edn_B (3D-footprint 20231221), 5edn_J (3D-footprint 20231221), 5eea_B (3D-footprint 20231221), 5eg0_B (3D-footprint 20231221) |
Names: | Homeobox protein Hox-B13, HXB13_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q92826 |
Length: | 61 |
Pfam Domains: | 1-57 Homeobox domain |
Sequence: (in bold interface residues) | 1 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLA 60 61 K |
Interface Residues: | 1, 2, 3, 4, 12, 28, 30, 42, 43, 45, 46, 49, 50, 53, 54, 57 |
3D-footprint Homologues: | 6a8r_A, 1fjl_B, 5zfz_A, 1ig7_A, 2h1k_B, 1puf_A, 3cmy_A, 1nk2_P, 1zq3_P, 2lkx_A, 7q3o_C, 6es3_K, 2ld5_A, 2hdd_A, 7psx_B, 2r5y_A, 6m3d_C, 1au7_A, 5jlw_D, 3lnq_A, 2hos_A, 4xrs_G, 1b72_A, 3rkq_B, 5flv_I, 3a01_E, 5zjt_E, 4cyc_A, 1jgg_B, 6vu3_A, 6vz3_A, 1e3o_C, 2xsd_C, 1le8_A, 7xrc_C, 1mnm_C, 4qtr_D, 1puf_B, 1k61_B, 1o4x_A, 6fqp_B, 1le8_B, 1du0_A, 6fqq_E, 5hod_A |
Binding Motifs: | 5edn_AJ ATAAAnnnCnnTTnnnnTTTAT 5edn_BG gnnnnnGTAAAnnnnnGnnnnnntnaCTAG 5edn_J TnGTAAA 5eea_B tTTaTTGnG 5eg0_AB TnGTAAAnnTGTCA 5eg0_B tngTAAA |
Binding Sites: | 5eea_D 5eea_E 5eg0_D 5eg0_E 5edn_K 5edn_L |
Publications: | Morgunova E, Yin Y, Das PK, Jolma A, Zhu F, Popov A, Xu Y, Nilsson L, Taipale J. Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima. Elife : (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.