Transcription Factor

Accessions: Q9C960 (JASPAR 2024), T01182 (AthalianaCistrome v4_May2016)
Names: AGAMOUS-like 55, Q9C960_ARATH, Uncharacterized protein T7P1.6, AGL55, AT1G60920, T01182;
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2024 1, AthalianaCistrome v4_May2016 2
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:MADS
Length: 191
Pfam Domains: 11-49 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence:
(in bold interface residues)
1 MGGTKRKIEMKRIEDKNVRAVAFTKRKSGLFHKASELCLLSPGTQIAILATPLSSHSHAS 60
61 FYSFGHSSVDHVVSSLLHNQHPSLPTNQDNRSGLGFWWEDQAFDRLENVDELKEAVDAVS 120
121 RMLNNVRLRLDDAVKSNQRDGSLVIHQEDEEVLQLGYKDTNQITKLEGETSASASLLKNV 180
181 VDNLHIDDRYY
Interface Residues: 5, 6, 17, 20, 21, 25, 146
3D-footprint Homologues: 8q9p_B, 1egw_B, 8q9q_A, 7xuz_H, 8q9r_F, 8q9n_B, 1c7u_A, 1n6j_A, 1mnm_A, 1hbx_A, 4xzf_A
Binding Motifs: M0490 / MA1202.1 TCACCA
Publications: Tang W., Perry S. E. Binding site selection for the plant MADS domain protein AGL15: an in vitro and in vivo study.. J. Biol. Chem. 278:28154-28159 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.