Transcription Factor
| Accessions: | E2F6_HUMAN (HOCOMOCO 10), O75461 (JASPAR 2024) |
| Names: | E2F-6, E2F6_HUMAN, Transcription factor E2F6 |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | O75461 |
| Length: | 281 |
| Pfam Domains: | 63-128 E2F/DP family winged-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVK 60 61 RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS 120 121 KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERL 180 181 AYVTYQDIHSIQAFHEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ 240 241 GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN |
| Interface Residues: | 63, 86, 88, 90, 92, 94, 99, 100, 101, 102, 104, 107, 115, 117, 119, 121, 124, 126 |
| 3D-footprint Homologues: | 1cf7_A, 4yo2_A, 6uwj_A, 1cf7_B |
| Binding Motifs: | MA0471.1 rGGCGGGArrv E2F6_HUMAN.H10MO.C|M01091 kkGGCGGGArrg MA0471.2 grrGGCGGGAArs MA0471.3 GGCGGGAA |
| Binding Sites: | MA0471.3.2 / MA0471.3.5 MA0471.3.11 MA0471.3.14 / MA0471.3.19 MA0471.3.15 MA0471.1.1 MA0471.1.10 MA0471.1.11 MA0471.1.12 MA0471.1.13 MA0471.1.14 MA0471.1.15 MA0471.1.16 MA0471.1.17 MA0471.1.18 MA0471.1.19 MA0471.1.2 MA0471.1.20 MA0471.1.3 MA0471.1.4 MA0471.1.5 MA0471.1.6 MA0471.1.7 MA0471.1.8 MA0471.1.9 MA0471.2.1 MA0471.2.10 / MA0471.2.9 MA0471.2.10 / MA0471.2.11 MA0471.2.11 / MA0471.2.12 MA0471.2.12 / MA0471.2.13 MA0471.2.14 MA0471.2.13 / MA0471.2.15 MA0471.2.14 / MA0471.2.16 MA0471.2.15 / MA0471.2.17 MA0471.2.16 / MA0471.2.18 MA0471.2.17 / MA0471.2.19 MA0471.2.2 MA0471.2.18 / MA0471.2.20 MA0471.2.3 MA0471.2.4 MA0471.2.5 MA0471.2.6 MA0471.2.7 MA0471.2.8 MA0471.2.8 / MA0471.2.9 MA0471.2.19 MA0471.2.20 MA0471.3.1 / MA0471.3.17 / MA0471.3.18 / MA0471.3.6 MA0471.3.10 / MA0471.3.8 MA0471.3.12 / MA0471.3.3 MA0471.3.13 MA0471.3.16 MA0471.3.20 MA0471.3.4 MA0471.3.7 MA0471.3.9 |
| Publications: | Xu X., Bieda M., Jin V. X., Rabinovich A., Oberley M. J., Green R., Farnham P. J. A comprehensive ChIP-chip analysis of E2F1, E2F4, and E2F6 in normal and tumor cells reveals interchangeable roles of E2F family members.. Genome Res. 17:1550-1561 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.