Transcription Factor
Accessions: | P50539 (JASPAR 2024) |
Names: | bHLHc11, Class C basic helix-loop-helix protein 11, Max interactor 1, Max-interacting protein 1, MXI1_HUMAN |
Organisms: | Homo sapiens |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | P50539 |
Length: | 228 |
Pfam Domains: | 69-120 Helix-loop-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSG 60 61 SSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLE 120 121 EAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVD 180 181 VESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS |
Interface Residues: | 72, 73, 75, 76, 79, 80 |
3D-footprint Homologues: | 7f2f_B, 7rcu_E, 8ia3_B, 7d8t_A |
Binding Motifs: | MA1108.1 ssrCCACGTGsss MA1108.2 rvCACATGkc MA1108.3 CACATG |
Binding Sites: | MA1108.3.10 / MA1108.3.11 / MA1108.3.12 / MA1108.3.13 / MA1108.3.14 / MA1108.3.15 / MA1108.3.17 / MA1108.3.18 / MA1108.3.19 / MA1108.3.3 / MA1108.3.4 / MA1108.3.5 / MA1108.3.6 / MA1108.3.7 / MA1108.3.8 / MA1108.3.9 MA1108.3.1 / MA1108.3.2 MA1108.2.10 MA1108.1.1 MA1108.1.10 MA1108.1.11 MA1108.1.12 MA1108.1.13 MA1108.1.14 MA1108.1.15 MA1108.1.16 MA1108.1.17 MA1108.1.18 MA1108.1.19 MA1108.1.2 MA1108.1.20 MA1108.1.3 MA1108.1.4 MA1108.1.5 MA1108.1.6 MA1108.1.7 MA1108.1.8 MA1108.1.9 MA1108.2.1 MA1108.2.11 MA1108.2.12 MA1108.2.13 / MA1108.2.6 MA1108.2.14 / MA1108.2.7 MA1108.2.15 MA1108.2.16 MA1108.2.17 MA1108.2.18 MA1108.2.19 / MA1108.2.8 MA1108.2.2 MA1108.2.20 / MA1108.2.9 MA1108.2.3 MA1108.2.4 MA1108.2.1 / MA1108.2.5 MA1108.2.2 / MA1108.2.6 MA1108.2.3 / MA1108.2.7 MA1108.2.4 / MA1108.2.8 MA1108.2.5 / MA1108.2.9 MA1108.2.10 / MA1108.2.12 MA1108.2.11 MA1108.2.13 MA1108.2.14 MA1108.2.15 MA1108.2.16 MA1108.2.17 MA1108.2.18 MA1108.2.19 MA1108.2.20 MA1108.3.16 MA1108.3.20 |
Publications: | Zervos A. S., Gyuris J., Brent R. Mxi1, a protein that specifically interacts with Max to bind Myc-Max recognition sites. Cell 72:223-232 (1993). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.