Transcription Factor

Accessions: T015166_1.02 (CISBP 1.02), P35428 (JASPAR 2024)
Names: Hes1, T015166_1.02;, Hairy and enhancer of split 1, HES1_MOUSE, Transcription factor HES-1
Organisms: Mus musculus
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:bHLH
Length: 282
Pfam Domains: 35-92 Helix-loop-helix DNA-binding domain
109-150 Hairy Orange
Sequence:
(in bold interface residues)
1 MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL 60
61 ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE 120
121 VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPAGPQHA 180
181 PFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAF 240
241 AHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMWRPWRN
Interface Residues: 36, 38, 39, 40, 42, 43, 46, 47, 75
3D-footprint Homologues: 7z5k_B, 1an4_A, 8hov_A, 1am9_A, 6g1l_A, 7d8t_A, 4h10_A, 8osl_P, 5nj8_C
Binding Motifs: M0191_1.02 ssCACGygyc
MA1099.1 ssCACGygyc
Publications: Murata K, Hattori M, Hirai N, Shinozuka Y, Hirata H, Kageyama R, Sakai T, Minato N. Hes1 directly controls cell proliferation through the transcriptional repression of p27Kip1. Mol Cell Biol 25:4262-71 (2005). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.