Transcription Factor
| Accessions: | 4xrs_I (3D-footprint 20231221) |
| Names: | DLX3_HUMAN, Homeobox protein DLX-3 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | O60479 |
| Length: | 56 |
| Pfam Domains: | 1-56 Homeobox domain |
| Sequence: (in bold interface residues) | 1 KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK |
| Interface Residues: | 1, 2, 3, 41, 42, 44, 45, 48, 49, 52, 53, 56 |
| 3D-footprint Homologues: | 2lkx_A, 6m3d_C, 1nk2_P, 1zq3_P, 6es3_K, 2ld5_A, 7q3o_C, 3a01_E, 2h1k_B, 1b72_A, 5flv_I, 3lnq_A, 1puf_A, 1ig7_A, 5zjt_E, 3cmy_A, 2hdd_A, 5hod_A, 3rkq_B, 2r5y_A, 1jgg_B, 6a8r_A, 3d1n_M, 2hos_A, 7psx_B, 5jlw_D, 4cyc_A, 1au7_A, 4xrs_G, 1fjl_B, 5zfz_A, 4j19_B, 1le8_A, 7xrc_C, 1e3o_C, 2xsd_C, 6fqq_E, 4qtr_D, 1mnm_C, 1du0_A, 1puf_B, 8g87_X, 4xrm_B, 1k61_B, 3l1p_A, 1o4x_A |
| Binding Motifs: | 4xrs_BI ganmngatA |
| Binding Sites: | 4xrs_D 4xrs_E |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.