Transcription Factor

Accessions: 1ga5_F (3D-footprint 20241219)
Names: EAR-1, NR1D1_HUMAN, Nuclear receptor subfamily 1 group D member 1, ORPHAN NUCLEAR RECEPTOR NR1D1, Rev-erbA-alpha, V-erbA-related protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20393
Length: 78
Pfam Domains: 3-72 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 VLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQC 60
61 RFKKCLSVGMSRDAVRFG
Interface Residues: 13, 15, 22, 25, 26, 29, 30, 55, 77
3D-footprint Homologues: 6l6q_B, 7wnh_D, 3g9m_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 2nll_B, 5cbz_E, 3g6t_A, 8rm6_A, 7prw_B, 5cbx_B
Binding Motifs: 1ga5_F tGaCC
Binding Sites: 1ga5_G
1ga5_H
Publications: Sierk M.L, Zhao Q, Rastinejad F. DNA deformability as a recognition feature in the reverb response element. Biochemistry 40:12833-43 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.