Transcription Factor

						

			
Accessions: 1apl_C (3D-footprint 20231221)

			
Names: Alpha-2 repressor, MAT-ALPHA2 HOMEODOMAIN, MATalpha2 protein, Mating-type protein ALPHA2, MTAL2_YEAST
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CY08
Length: 59
Pfam Domains:      5-58 Homeobox domain
    17-55 Homeobox KN domain
Sequence: 
(in bold interface residues)		   1 YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT
Interface Residues: 2, 4, 5, 44, 45, 47, 48, 51, 52, 55, 56
3D-footprint Homologues: 1mnm_C, 1k61_B, 1le8_B, 4j19_B, 2ld5_A, 5jlw_D, 2xsd_C, 7q3o_C, 1e3o_C, 7xrc_C, 1ig7_A, 7psx_B, 4xrs_G, 1nk2_P, 1du0_A, 6es3_K, 3rkq_B, 5flv_I, 3a01_E, 1puf_B, 6fqp_B, 3cmy_A, 1zq3_P, 6fqq_E, 4xrm_B, 2lkx_A, 1b72_A, 8g87_X, 5zjt_E, 3d1n_M, 2hdd_A, 1jgg_B, 2hos_A
Binding Motifs: 1apl_CD TTGTAnTTnATnTACA
			
Publications: Wolberger C., Vershon A. K., Liu B., Johnson A. D., Pabo C. O. Crystal structure of a MATalpha2 homeodomain-operator complex suggests a general model for homeodomain-DNA interactions. Cell 67:517-528 (1991). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.