Transcription Factor

Accessions: Solyc02g094290.1.1 (EEADannot 2026-03-04)
Names: TCP20
Organisms: Solanum lycopersicum
Libraries: EEADannot 2026-03-04 1
1 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed]
Notes: family:TCP
Length: 113
Pfam Domains: 31-99 TCP family transcription factor
Sequence:
(in bold interface residues)
1 MKRQNTNNTMEMKDFQIGIAEKDEAKKHQLAPKRKSNKDRHTKVEGRGRRIRMPALCAAR 60
61 IFQLTRELGHKSDGETIQWLLQKAEPSIIAATGHGTIQASLYRRLDPLFRNRE
Interface Residues: 39, 40, 41, 50, 52
3D-footprint Homologues: 7vp3_D, 7vp2_B
Binding Motifs: EEAD0646 wkGTRGGAMYMMCskmwmwTg
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.