Transcription Factor
| Accessions: | T028095_1.02 (CISBP 1.02), UP00428A (UniPROBE 20160601), P03069 (JASPAR 2024) |
| Names: | GCN4, T028095_1.02;, AAS3, Amino acid biosynthesis regulatory protein, ARG9, General control protein GCN4, YEL009C, GCN4_YEAST, General control transcription factor GCN4 |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | CISBP 1.02 1, UniPROBE 20160601 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Hume MA, Barrera LA, Gisselbrecht SS, Bulyk ML. UniPROBE, update 2015: new tools and content for the online database of protein-binding microarray data on protein-DNA interactions. Nucleic Acids Res : (2015). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Description: | Transcriptional activator of amino acid biosynthetic genes in response to amino acid starvation; expression is tightly regulated at both the transcriptional and translational levels |
| Notes: | experiment type:PBM, family:bZIP |
| Length: | 281 |
| Pfam Domains: | 223-278 bZIP transcription factor 225-276 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQD 60 61 TPSNLDFDFALPQTATAPDAKTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEW 120 121 TSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTTSFLPTPVLEDAKLTQTRKVK 180 181 KPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR 240 241 RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER |
| Interface Residues: | 232, 234, 235, 236, 237, 238, 239, 242, 243 |
| 3D-footprint Homologues: | 6mg1_B, 8k8c_A, 1llm_D, 5t01_B, 5vpe_D, 2dgc_A |
| Binding Motifs: | MA0303.1 crwdrkrTGAsTCAymcwtmw UP00428A_1 wrdrTGAsTCAywa M0352_1.02 krTGActcay MA0303.2 raTGASTCAty MA0303.3 TGASTCAt |
| Binding Sites: | GTGACTCA TGACGTCA GTGACTAA AGAGTCAC ATGACGCA ATGACTAA ATGACTCA ATGACTCG ATGAGTCA ATTAGTCA CATGACTC CTGACTCA CTGAGTCA GAGTCACA GAGTCACC GAGTCATA GAGTCATC GTGAGTCA MA0303.3.19 / MA0303.3.5 / MA0303.3.8 / TGACTCAA TGAGTCAA MA0303.2.9 MA0303.2.10 MA0303.2.1 MA0303.2.11 MA0303.2.12 / MA0303.2.13 MA0303.2.13 / MA0303.2.14 MA0303.2.14 / MA0303.2.15 MA0303.2.15 / MA0303.2.16 MA0303.2.16 / MA0303.2.17 MA0303.2.17 / MA0303.2.18 MA0303.2.18 / MA0303.2.19 MA0303.2.19 / MA0303.2.20 MA0303.2.2 MA0303.2.20 MA0303.2.3 MA0303.2.4 MA0303.2.5 MA0303.2.6 MA0303.2.7 MA0303.2.8 MA0303.2.12 MA0303.3.1 / MA0303.3.16 / MA0303.3.18 / MA0303.3.6 / MA0303.3.7 MA0303.3.10 / MA0303.3.2 / MA0303.3.3 MA0303.3.11 MA0303.3.12 MA0303.3.13 / MA0303.3.17 MA0303.3.14 MA0303.3.15 MA0303.3.20 MA0303.3.4 / MA0303.3.9 |
| Publications: | Alibés A, Nadra AD, De Masi F, Bulyk ML, Serrano L, Stricher F. Using protein design algorithms to understand the molecular basis of disease caused by protein-DNA interactions: the Pax6 example. Nucleic Acids Res. (2010) Aug 4. [Pubmed] Newburger D.E, Bulyk M.L. UniPROBE: an online database of protein binding microarray data on protein-DNA interactions. Nucleic acids research 37:D77-82 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.