Transcription Factor
| Accessions: | FOXA3 (HT-SELEX2 May2017), FOXA3_HUMAN (HOCOMOCO 10), P55318 (JASPAR 2024) |
| Names: | ENSG00000170608, FOXA3, Fork head-related protein FKH H3, Forkhead box protein A3, FOXA3_HUMAN, Hepatocyte nuclear factor 3-gamma, HNF-3-gamma, HNF-3G, TCF-3G, Transcription factor 3G |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: Forkhead experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: Forkhead experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 350 |
| Pfam Domains: | 16-116 Forkhead N-terminal region 117-212 Fork head domain 301-322 HNF3 C-terminal domain |
| Sequence: (in bold interface residues) | 1 MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL 60 61 PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY 120 121 SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR 180 181 SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST 240 241 TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF 300 301 NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS |
| Interface Residues: | 107, 109, 111, 112, 114, 157, 160, 162, 163, 164, 166, 167, 168, 170, 171, 180, 187, 212 |
| 3D-footprint Homologues: | 7yz7_A, 7yzb_A, 3l2c_A, 7vox_H, 2hdc_A, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 6el8_A, 7tdx_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 3qrf_G |
| Binding Motifs: | FOXA3_3 csYTAwGTAAACAAAs FOXA3_4 ywrwGTmAATATTTrCwyWr FOXA3_methyl_1 csyTAwGTAAACAAws FOXA3_methyl_2 tWrwGTmAATATTTrCwywr FOXA3_HUMAN.H10MO.C|M01144 hTrTTTryttwby MA1683.1 rwGTAAACAww MA1683.2 GTAAACA |
| Binding Sites: | MA1683.2.1 MA1683.2.17 MA1683.1.14 / MA1683.1.16 MA1683.1.14 MA1683.1.15 / MA1683.1.17 MA1683.2.11 / MA1683.2.12 / MA1683.2.13 / MA1683.2.15 / MA1683.2.18 / MA1683.2.19 / MA1683.2.20 / MA1683.2.4 MA1683.1.13 / MA1683.1.15 MA1683.1.3 / MA1683.1.4 MA1683.1.10 / MA1683.1.11 MA1683.1.11 / MA1683.1.12 MA1683.1.12 / MA1683.1.13 MA1683.1.1 / MA1683.1.2 MA1683.1.16 MA1683.1.17 / MA1683.1.18 MA1683.1.18 / MA1683.1.19 MA1683.1.19 / MA1683.1.20 MA1683.1.2 MA1683.1.20 MA1683.1.4 / MA1683.1.5 MA1683.1.5 / MA1683.1.6 MA1683.1.6 / MA1683.1.7 MA1683.1.7 / MA1683.1.8 MA1683.1.8 MA1683.1.10 / MA1683.1.9 MA1683.1.1 MA1683.1.3 MA1683.1.9 MA1683.2.7 / MA1683.2.9 MA1683.2.16 MA1683.2.3 MA1683.2.14 MA1683.2.10 / MA1683.2.6 / MA1683.2.8 MA1683.2.2 / MA1683.2.5 |
| Publications: | Motallebipour M, Ameur A, Reddy Bysani MS, Patra K, Wallerman O, Mangion J, Barker MA, McKernan KJ, Komorowski J, Wadelius C. Differential binding and co-binding pattern of FOXA1 and FOXA3 and their relation to H3K4me3 in HepG2 cells revealed by ChIP-seq. Genome Biol : (2009;10(11):R129.). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.