Transcription Factor

Accessions: ONECUT3_DBD (HumanTF 1.0), ONECUT3 (HT-SELEX2 May2017)
Names: OC-3, One cut domain family member 3, One cut homeobox 3, ONEC3_HUMAN, ONECUT3, Transcription factor ONECUT-3, ENSG00000205922
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: O60422
Notes: Ensembl ID: ENSG00000205922; DNA-binding domain sequence; TF family: Homeodomain+cut; Clone source: Gene synthesis, TF family: CUT_Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: CUT_Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 196
Pfam Domains: 20-97 CUT domain
118-171 Homeobox domain
Sequence:
(in bold interface residues)
1 PHGGGGGPGGSGGGPSAGAAAEEINTKEVAQRITAELKRYSIPQAIFAQRILCRSQGTLS 60
61 DLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQRMSALRLAACKRKEQEQQKERALQPKKQ 120
121 RLVFTDLQRRTLIAIFKENKRPSKEMQVTISQQLGLELNTVSNFFMNARRRCMNRWAEEP 180
181 STAPGGPAGATATFSK
Interface Residues: 55, 56, 58, 60, 61, 118, 120, 121, 130, 159, 162, 163, 166, 167, 169, 170, 171
3D-footprint Homologues: 2o4a_A, 2d5v_B, 8pmf_A, 7q3o_C, 5hod_A, 8ik5_C, 1au7_A, 1e3o_C, 8bx1_A, 6fqp_B, 1o4x_A, 8g87_X, 4qtr_D, 6fqq_E, 1puf_B, 4xrm_B
Binding Motifs: ONECUT3_DBD aaAAAATCrATAaw
ONECUT3_2 gyATYGATyg
ONECUT3_methyl_1 kTATTGATyk
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.