Transcription Factor
Accessions: | ZNF528 (humanC2H2ZF-ChIP Feb2015), Q3MIS6 (JASPAR 2024) |
Names: | ENSG00000167555, Q3MIS6, ZNF528, ZN528_HUMAN |
Organisms: | Homo sapiens |
Libraries: | humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2 1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Notes: | TF family: C2H2;KRAB experiment: ChIP-seq/MEME/B1H-RC |
Length: | 628 |
Pfam Domains: | 9-48 KRAB box 207-224 Zinc-finger double domain 212-235 C2H2-type zinc finger 213-235 C2H2-type zinc finger 213-235 Zinc finger, C2H2 type 228-252 Zinc-finger double domain 240-261 C2H2-type zinc finger 241-263 C2H2-type zinc finger 241-263 Zinc finger, C2H2 type 255-279 Zinc-finger double domain 268-289 C2H2-type zinc finger 269-291 C2H2-type zinc finger 269-291 Zinc finger, C2H2 type 284-307 Zinc-finger double domain 296-317 C2H2-type zinc finger 297-319 Zinc finger, C2H2 type 297-319 C2H2-type zinc finger 311-336 Zinc-finger double domain 325-347 C2H2-type zinc finger 325-347 Zinc finger, C2H2 type 325-347 C2H2-type zinc finger 340-363 Zinc-finger double domain 352-371 C2H2-type zinc finger 353-375 C2H2-type zinc finger 353-375 Zinc finger, C2H2 type 368-391 Zinc-finger double domain 380-391 C2H2-type zinc finger 381-403 C2H2-type zinc finger 381-403 Zinc finger, C2H2 type 396-419 Zinc-finger double domain 409-431 C2H2-type zinc finger 409-431 Zinc finger, C2H2 type 411-431 C2H2-type zinc finger 424-446 Zinc-finger double domain 436-455 C2H2-type zinc finger 437-459 C2H2-type zinc finger 437-459 Zinc finger, C2H2 type 451-475 Zinc-finger double domain 464-483 C2H2-type zinc finger 465-485 C2H2-type zinc finger 465-487 Zinc finger, C2H2 type 479-504 Zinc-finger double domain 492-513 C2H2-type zinc finger 493-515 C2H2-type zinc finger 493-515 Zinc finger, C2H2 type 507-531 Zinc-finger double domain 520-531 C2H2-type zinc finger 521-543 Zinc finger, C2H2 type 521-543 C2H2-type zinc finger 536-558 Zinc-finger double domain 549-571 C2H2-type zinc finger 549-571 Zinc finger, C2H2 type 549-567 C2H2-type zinc finger 564-587 Zinc-finger double domain 577-593 C2H2-type zinc finger 577-596 C2H2-type zinc finger 577-599 Zinc finger, C2H2 type 591-616 Zinc-finger double domain 604-627 C2H2-type zinc finger 605-627 C2H2-type zinc finger 605-627 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 MALTQGPLKFMDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGICLPDLSVTSML 60 61 EQKRDPWTLQSEEKIANDPDGRECIKGVNTERSSKLGSNAGNKPCKNQLGFTFQLHLSDL 120 121 QLFQAERKISGCKHFEKPVSDNSSVSPLEKISSSVKSHLLNKYRNNFDHAPLLPQEQKAH 180 181 IREKAYKCNEHGQVFRASASLTNQVIHNADNPYKCSECGKVFSCSSKLVIHRRMHTGEKP 240 241 YKCHECGKLFSSNSNLSQHQRIHTGEKPYKCHECDKVFRSSSKLAQHQRIHTGEKPYKCH 300 301 ECDKVFNQIAHLVRHQKIHTGEKPYSCNKCGKVFSRHSYLAEHQTVHTGEKPYKCEECGK 360 361 AFSVRSSLITHQLIHTGRKPYKCKECDKVFGRKCFLTSHQRIHTRERPYGCSQCGKIFSQ 420 421 KSDLIRHRKTHTDEKPYKCNKCGTAFREFSDLTAHFLIHSGEKPYECKECGKVFRYKSSL 480 481 TSHHRIHTGEKPYKCNRCGKVFSRSSNLVCHQKIHTGEKPYKCNQCGKVFNQASYLTRHQ 540 541 IIHTGERPYRCSKCGKAFRGCSGLTAHLAIHTEKKSHECKECGKIFTQKSSLTNHHRIHI 600 601 GEKPYKCTLCSKVFSHNSDLAQHQRVHS |
Interface Residues: | 111, 158, 161, 193, 196, 223, 224, 226, 227, 230, 232, 234, 235, 236, 238, 243, 251, 252, 254, 255, 257, 258, 260, 261, 264, 279, 280, 281, 282, 283, 286, 290, 307, 308, 309, 310, 311, 313, 314, 335, 336, 337, 338, 339, 340, 342, 346, 363, 364, 365, 366, 367, 369, 370, 392, 393, 394, 395, 398, 401, 419, 421, 422, 423, 426, 432, 437, 446, 448, 449, 450, 451, 454, 458, 475, 476, 477, 478, 479, 482, 503, 504, 505, 506, 507, 509, 510, 532, 533, 534, 535, 537, 538, 539, 560, 561, 562, 563, 564, 565, 566, 567 |
3D-footprint Homologues: | 6dnw_A, 7y3l_A, 7w1m_H, 2i13_A, 5kkq_D, 5ei9_F, 5k5i_A, 2gli_A, 7y3m_I, 6e94_A, 5yel_A, 6jnm_A, 1mey_C, 6u9q_A, 5yj3_D, 5und_A, 6wmi_A, 6a57_A, 2jpa_A, 1tf3_A, 8ssq_A, 1tf6_A, 5v3j_F, 4x9j_A, 8ssu_A, 1f2i_J, 7n5w_A, 6blw_A, 8gn3_A, 5kl3_A, 7txc_E, 8h9h_G, 3uk3_C, 5k5l_F, 8cuc_F, 7eyi_G, 2kmk_A, 7ysf_A, 1ubd_C, 6ml4_A, 2drp_D, 1g2f_F, 1llm_D, 2lt7_A, 2wbs_A, 4m9v_C |
Binding Motifs: | ZNF528_ChIP GGAAGyCAT MA1597.1 cccAGGGAAGcCATTtC |
Binding Sites: | MA1597.1.1 MA1597.1.10 / MA1597.1.9 MA1597.1.10 / MA1597.1.11 MA1597.1.11 / MA1597.1.12 MA1597.1.12 / MA1597.1.13 MA1597.1.13 / MA1597.1.14 MA1597.1.14 / MA1597.1.15 MA1597.1.16 MA1597.1.17 MA1597.1.18 MA1597.1.19 MA1597.1.1 / MA1597.1.2 MA1597.1.20 MA1597.1.2 / MA1597.1.3 MA1597.1.3 / MA1597.1.4 MA1597.1.4 / MA1597.1.5 MA1597.1.5 / MA1597.1.6 MA1597.1.6 / MA1597.1.7 MA1597.1.7 / MA1597.1.8 MA1597.1.8 / MA1597.1.9 MA1597.1.15 MA1597.1.20 |
Publications: | Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.