Transcription Factor

Accessions: 6a57_A (3D-footprint 20250804)
Names: EC 1.14.11.-, Jumonji domain-containing protein 12, Lysine-specific demethylase REF6, Lysine-specific histone demethylase REF6, Protein RELATIVE OF EARLY FLOWERING 6, REF6_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9STM3
Length: 131
Pfam Domains: 19-44 Zinc finger, C2H2 type
19-42 C2H2-type zinc finger
43-66 C2H2-type zinc finger
44-66 Zinc finger, C2H2 type
59-84 Zinc-finger double domain
73-96 C2H2-type zinc finger
90-113 Zinc-finger double domain
102-128 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 EKEEEEEEEENEEEECAAYQCNMEGCTMSFSSEKQLMLHKRNICPIKGCGKNFFSHKYLV 60
61 QHQRVHSDDRPLKCPWKGCKMTFKWAWSRTEHIRVHTGARPYVCAEPDCGQTFRFVSDFS 120
121 RHKRKTGHSVK
Interface Residues: 32, 34, 35, 37, 38, 40, 41, 42, 54, 55, 56, 57, 58, 60, 61, 65, 84, 85, 86, 87, 88, 89, 90, 91, 92, 95, 114, 115, 116, 117, 118, 119, 120, 121, 122
3D-footprint Homologues: 5ei9_F, 5v3j_F, 1tf6_A, 1ubd_C, 2jpa_A, 6jnm_A, 1tf3_A, 6ml4_A, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 4x9j_A, 5kl3_A, 7txc_E, 1f2i_J, 7ysf_A, 6blw_A, 2kmk_A, 1g2f_F, 6u9q_A, 5kkq_D, 2gli_A, 8h9h_G, 6e94_A, 2lt7_A, 6a57_A, 7w1m_H, 2wbs_A, 8ssq_A, 5k5i_A, 5yel_A, 1llm_D, 8gn3_A, 4m9v_C, 7y3m_I, 5yj3_D
Binding Motifs: 6a57_A ACAGAG
Binding Sites: 6a57_B
6a57_C
Publications: Tian Z, Li X, Li M, Wu W, Zhang M, Tang C, Li Z, Liu Y, Chen Z, Yang M, Ma L, Caba C, Tong Y, Lam HM, Dai S, Chen Z. Crystal structures of REF6 and its complex with DNA reveal diverse recognition mechanisms. Cell Discov : (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.