Transcription Factor
| Accessions: | 6a57_A (3D-footprint 20250804) |
| Names: | EC 1.14.11.-, Jumonji domain-containing protein 12, Lysine-specific demethylase REF6, Lysine-specific histone demethylase REF6, Protein RELATIVE OF EARLY FLOWERING 6, REF6_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9STM3 |
| Length: | 131 |
| Pfam Domains: | 19-44 Zinc finger, C2H2 type 19-42 C2H2-type zinc finger 43-66 C2H2-type zinc finger 44-66 Zinc finger, C2H2 type 59-84 Zinc-finger double domain 73-96 C2H2-type zinc finger 90-113 Zinc-finger double domain 102-128 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 EKEEEEEEEENEEEECAAYQCNMEGCTMSFSSEKQLMLHKRNICPIKGCGKNFFSHKYLV 60 61 QHQRVHSDDRPLKCPWKGCKMTFKWAWSRTEHIRVHTGARPYVCAEPDCGQTFRFVSDFS 120 121 RHKRKTGHSVK |
| Interface Residues: | 32, 34, 35, 37, 38, 40, 41, 42, 54, 55, 56, 57, 58, 60, 61, 65, 84, 85, 86, 87, 88, 89, 90, 91, 92, 95, 114, 115, 116, 117, 118, 119, 120, 121, 122 |
| 3D-footprint Homologues: | 5ei9_F, 5v3j_F, 1tf6_A, 1ubd_C, 2jpa_A, 6jnm_A, 1tf3_A, 6ml4_A, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 4x9j_A, 5kl3_A, 7txc_E, 1f2i_J, 7ysf_A, 6blw_A, 2kmk_A, 1g2f_F, 6u9q_A, 5kkq_D, 2gli_A, 8h9h_G, 6e94_A, 2lt7_A, 6a57_A, 7w1m_H, 2wbs_A, 8ssq_A, 5k5i_A, 5yel_A, 1llm_D, 8gn3_A, 4m9v_C, 7y3m_I, 5yj3_D |
| Binding Motifs: | 6a57_A ACAGAG |
| Binding Sites: | 6a57_B 6a57_C |
| Publications: | Tian Z, Li X, Li M, Wu W, Zhang M, Tang C, Li Z, Liu Y, Chen Z, Yang M, Ma L, Caba C, Tong Y, Lam HM, Dai S, Chen Z. Crystal structures of REF6 and its complex with DNA reveal diverse recognition mechanisms. Cell Discov : (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.