Transcription Factor

Accessions: 6wc2_B (3D-footprint 20260701)
Names: MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A, MEF2A_HUMAN, Serum response factor-like protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q02078
Length: 88
Pfam Domains: 6-55 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence:
(in bold interface residues)
1 KIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDK 60
61 VLLKYTEYSEPHESRTNTDILETLKRRE
Interface Residues: 11, 14, 15, 19, 53, 64
3D-footprint Homologues: 8q9q_A, 1mnm_A, 1c7u_A, 1hbx_A, 8q9p_B, 1egw_B, 7xuz_H, 8q9r_F, 8q9n_B, 1n6j_A, 7yq3_E
Binding Motifs: 6wc2_ABO CTAnnnnnGGAAAAngC
Publications: Lei X, Zhao J, Sagendorf JM, Rajashekar N, Xu J, Dantas Machado AC, Sen C, Rohs R, Feng P, Chen L. Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface. J Mol Biol 432:5499-5508 (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.