Transcription Factor

Accessions: T037190_1.02 (CISBP 1.02)
Names: odd-2, T037190_1.02;
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 254
Pfam Domains: 124-146 C2H2-type zinc finger
124-146 Zinc finger, C2H2 type
138-162 Zinc-finger double domain
152-174 C2H2-type zinc finger
152-174 Zinc finger, C2H2 type
166-189 Zinc-finger double domain
180-202 C2H2-type zinc finger
180-202 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MLPWQRQVPTSIFPQSNEQVFRMMLAQQHLQLQNFLQQRKMALLAMNPEIPMITDLKKAK 60
61 FDFTHMADSIESEQKIKEESVSPKMSPTLTTAAVRPFVPYDQPWFMIPGRGRTTGRAARP 120
121 KKEFICKYCDRHFTKSYNLLIHERTHTDERPYSCDVCGKAFRRQDHLRDHKYIHQKDRPF 180
181 KCEICGKGFCQSRTLLVHRATHDPNRHSIGAPVVPIKSETPLPELDPRVTLILQNLTDSF 240
241 NSTSMTSPQISPDR
Interface Residues: 68, 102, 104, 105, 106, 109, 110, 112, 113, 116, 124, 134, 135, 136, 137, 138, 140, 141, 142, 143, 144, 147, 159, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 173, 190, 191, 192, 193, 194, 195, 197
3D-footprint Homologues: 3v4r_B, 1tf6_A, 2gli_A, 6wmi_A, 5yel_A, 8ssu_A, 2kmk_A, 7y3l_A, 5v3j_F, 7n5w_A, 3uk3_C, 1tf3_A, 6jnm_A, 8cuc_F, 6ml4_A, 2i13_A, 8gn3_A, 1llm_D, 6blw_A, 5kkq_D, 1ubd_C, 6u9q_A, 4x9j_A, 1mey_C, 5kl3_A, 2drp_D, 5ei9_F, 5und_A, 1g2f_F, 7eyi_G, 4m9v_C, 8h9h_G, 7y3m_I, 6e94_A, 7ysf_A, 2lt7_A, 6a57_A, 2jpa_A, 7w1m_H, 2wbs_A, 7txc_E, 1f2i_J, 5yj3_D, 8ssq_A, 5k5i_A
Binding Motifs: M0384_1.02 mCrGTAGCa
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.