Transcription Factor

Accessions: TEAD3_DBD (HumanTF 1.0)
Names: DTEF-1, TEA domain family member 3, TEAD-3, TEAD3, TEAD3_HUMAN, Transcriptional enhancer factor TEF-5
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q99594
Notes: Ensembl ID: ENSG00000007866; DNA-binding domain sequence; TF family: TEA/ATTS; Clone source: Gene synthesis
Length: 110
Pfam Domains: 4-103 TEA/ATTS domain family
Sequence:
(in bold interface residues)
1 SSPGEAREDGPEGLDKGLDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGR 60
61 NELIARYIKLRTGKTRTRKQVSSHIQVLARKKVREYQVGIKAMNLDQVSK
Interface Residues: 57, 61, 78, 79, 82, 83, 86, 87, 90, 100
3D-footprint Homologues: 5gzb_A, 5no6_N, 6we1_D
Binding Motifs: TEAD3_DBD_1 rCATTCCwhrCATwCCw
TEAD3_DBD_2 rCATTCCw
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.