Transcription Factor
| Accessions: | EGR1_DBD (HumanTF 1.0), EGR1 (HT-SELEX2 May2017) |
| Names: | EGR1, TOE1_HUMAN, ENSG00000120738 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q96GM8 |
| Notes: | Ensembl ID: ENSG00000120738; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Megaman, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 123 |
| Pfam Domains: | 18-42 Zinc finger, C2H2 type 18-42 C2H2-type zinc finger 35-58 Zinc-finger double domain 48-70 Zinc finger, C2H2 type 48-70 C2H2-type zinc finger 62-86 Zinc-finger double domain 76-94 C2H2-type zinc finger 76-98 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRS 60 61 DHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASSATSSLS 120 121 SYP |
| Interface Residues: | 7, 30, 31, 32, 33, 34, 36, 37, 56, 58, 59, 60, 61, 62, 64, 65, 66, 86, 87, 88, 89, 90, 91, 92, 93, 94 |
| 3D-footprint Homologues: | 5ei9_F, 1tf3_A, 6jnm_A, 7n5w_A, 1mey_C, 5kl3_A, 7ysf_A, 1f2i_J, 6wmi_A, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 5k5l_F, 8ssu_A, 1tf6_A, 6ml4_A, 4x9j_A, 2i13_A, 6blw_A, 5kkq_D, 2wbs_A, 1ubd_C, 6u9q_A, 2jpa_A, 7eyi_G, 5v3j_F, 8h9h_G, 6e94_A, 2lt7_A, 6a57_A, 2drp_D, 3uk3_C, 8cuc_F, 7y3l_A, 7txc_E, 5k5i_A, 1llm_D, 5yel_A, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D |
| Binding Motifs: | EGR1_DBD tmCGCCCmCGCAww EGR1_2 cmCrCCCmCgCmm EGR1_methyl_1 cmCrCCCmCgcmc |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.