Transcription Factor
| Accessions: | T014203_1.02 (CISBP 1.02), MYOD1_HUMAN (HOCOMOCO 10), P15172 (JASPAR 2024) |
| Names: | MYOD1, T014203_1.02;, bHLHc1, Class C basic helix-loop-helix protein 1, Myf-3, Myoblast determination protein 1, MYOD1_HUMAN, Myogenic factor 3 |
| Organisms: | Homo sapiens |
| Libraries: | CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P15172 |
| Notes: | family:bHLH |
| Length: | 320 |
| Pfam Domains: | 22-109 Myogenic Basic domain 110-161 Helix-loop-helix DNA-binding domain 191-259 Myogenic determination factor 5 |
| Sequence: (in bold interface residues) | 1 MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE 60 61 EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR 120 121 RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA 180 181 PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP 240 241 GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS 300 301 PDAAPQCPAGANPNPIYQVL |
| Interface Residues: | 111, 114, 115, 117, 118, 119, 121, 122 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 5eyo_A, 5i50_B, 6od3_F, 1am9_A, 2ql2_A, 2ql2_D, 2ypa_B |
| Binding Motifs: | M3589_1.02 crmCACCTGtys MYOD1_HUMAN.H10MO.C|M01346 sCAsCTGty MA0499.2 cwgCACCTGTymy MA0499.3 gCACCTGTy |
| Binding Sites: | MA0499.3.17 / MA0499.3.19 / MA0499.3.3 MA0499.3.9 MA0499.3.15 / MA0499.3.16 / MA0499.3.20 MA0499.2.1 MA0499.2.10 / MA0499.2.5 MA0499.2.11 / MA0499.2.6 MA0499.2.12 MA0499.2.13 / MA0499.2.7 MA0499.2.14 / MA0499.2.8 MA0499.2.15 / MA0499.2.9 MA0499.2.16 MA0499.2.17 MA0499.2.13 / MA0499.2.18 MA0499.2.14 / MA0499.2.19 MA0499.2.2 MA0499.2.20 MA0499.2.1 / MA0499.2.3 MA0499.2.4 MA0499.2.5 MA0499.2.2 / MA0499.2.6 MA0499.2.3 / MA0499.2.7 MA0499.2.8 MA0499.2.4 / MA0499.2.9 MA0499.2.16 MA0499.2.10 MA0499.2.11 MA0499.2.12 MA0499.2.15 MA0499.2.17 MA0499.2.18 MA0499.2.19 MA0499.2.20 MA0499.3.1 MA0499.3.10 / MA0499.3.8 MA0499.3.11 MA0499.3.12 MA0499.3.13 MA0499.3.14 MA0499.3.18 MA0499.3.2 / MA0499.3.6 / MA0499.3.7 MA0499.3.4 MA0499.3.5 |
| Publications: | Cao Y, Yao Z, Sarkar D, Lawrence M, Sanchez G.J, Parker M.H, MacQuarrie K.L, Davison J, Morgan M.T, Ruzzo W.L, Gentleman R.C, Tapscott S.J. Genome-wide MyoD binding in skeletal muscle cells: a potential for broad cellular reprogramming. Developmental cell 18:662-74 (2010). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.