Transcription Factor

Accessions: HAHB4 (Athamap 20091028)
Names: HAHB4
Organisms: Helianthus annuus, Helianthus anuus
Libraries: Athamap 20091028 1
1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed]
Length: 181
Pfam Domains: 20-73 Homeobox domain
76-118 Homeobox associated leucine zipper
Sequence:
(in bold interface residues)
1 MSLQQVPTTETTTRKNRNEGRKRFTDKQISFLEYMFETQSRPELRMKHQLAHKLGLHPRQ 60
61 VAIWFQNKRARSKSRQIEQEYNALKHNYETLASKSESLKKENQALLNQLEVLRNVAEKHQ 120
121 EKTSSSGSGEESDDRFTNSPDVMFGQEMNVPFCDGFAYFEEGNSLLEIEEQLPDPQKWWE 180
181 F
Interface Residues: 17, 20, 21, 22, 23, 59, 60, 62, 63, 66, 67, 70, 71, 73, 74
3D-footprint Homologues: 3a01_E, 7q3o_C, 6es3_K, 1jgg_B, 5jlw_D, 3rkq_B, 2lkx_A, 1puf_B, 4xrs_G, 3d1n_M, 2hdd_A, 5zfz_A, 4cyc_A, 1fjl_B, 5flv_I, 2hos_A, 5hod_A, 3lnq_A, 1b72_A, 6a8r_A, 3cmy_A, 1nk2_P, 2ld5_A, 1le8_A, 7xrc_C, 1au7_A, 1ig7_A, 1du0_A, 2r5y_A, 1zq3_P, 3l1p_A, 8g87_X, 5zjt_E, 4qtr_D, 2d5v_B, 7psx_B, 1puf_A, 4xrm_B, 2h1k_B, 6m3d_C
Binding Motifs: HAHB4 TAATrATTg
Publications: Palena C. M., Gonzalez D. H., Chan R. L. A monomer-dimer equilibrium modulates the interaction of the sunflower homeodomain leucine-zipper protein Hahb-4 with DNA.. J. Biochem. 341 ( Pt 1):81-87 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.