Transcription Factor
Accessions: | 3cmy_A (3D-footprint 20231221) |
Names: | HuP2, Paired box protein Pax-3, PAX3_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P23760 |
Length: | 60 |
Pfam Domains: | 3-59 Homeobox domain 26-56 Homeobox KN domain |
Sequence: (in bold interface residues) | 1 GQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQ 60 |
Interface Residues: | 3, 4, 5, 6, 44, 45, 47, 48, 51, 52, 55, 56, 59 |
3D-footprint Homologues: | 1ig7_A, 2h1k_B, 1puf_A, 5zfz_A, 1fjl_B, 3cmy_A, 6a8r_A, 3d1n_M, 1jgg_B, 6m3d_C, 3lnq_A, 2lkx_A, 1nk2_P, 1zq3_P, 2ld5_A, 7q3o_C, 5jlw_D, 4cyc_A, 6es3_K, 4xrs_G, 4j19_B, 1au7_A, 3a01_E, 5flv_I, 1puf_B, 5zjt_E, 1b72_A, 2hdd_A, 7psx_B, 5hod_A, 3rkq_B, 2r5y_A, 2hos_A, 2xsd_C, 1e3o_C, 7xrc_C, 2h8r_B, 1ic8_B, 1le8_A, 1o4x_A, 1le8_B, 3l1p_A, 1mnm_C, 8g87_X, 1k61_B, 4qtr_D, 4xrm_B, 1du0_A |
Binding Motifs: | 3cmy_A GATTAT |
Binding Sites: | 3cmy_B 3cmy_C |
Publications: | Birrane G, Soni A, Ladias J.A. Structural basis for DNA recognition by the human PAX3 homeodomain. Biochemistry 48:1148-55 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.