Transcription Factor

Accessions: 3cmy_A (3D-footprint 20250804)
Names: HuP2, Paired box protein Pax-3, PAX3_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P23760
Length: 60
Pfam Domains: 3-59 Homeobox domain
26-56 Homeobox KN domain
Sequence:
(in bold interface residues)
1 GQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQ 60
Interface Residues: 3, 4, 5, 6, 44, 45, 47, 48, 51, 52, 54, 55, 56, 59
3D-footprint Homologues: 3d1n_M, 1fjl_B, 5zfz_A, 8pmf_A, 1ig7_A, 1puf_A, 8ejp_B, 6a8r_A, 3cmy_A, 1nk2_P, 1zq3_P, 6m3d_C, 3lnq_A, 2lkx_A, 1jgg_B, 2ld5_A, 6es3_K, 1au7_A, 4xrs_G, 2hos_A, 4j19_B, 1b72_A, 5flv_I, 5zjt_E, 3a01_E, 8ik5_C, 7psx_B, 5hod_A, 3rkq_B, 9b8u_A, 2hdd_A, 8osb_E, 7q3o_C, 5jlw_D, 4cyc_A, 2r5y_A, 1puf_B, 8eml_B, 8pi8_B, 7xrc_C, 2xsd_C, 1le8_A, 2h8r_B, 1e3o_C, 1k61_B, 8g87_X, 1o4x_A, 8bx1_A, 4qtr_D, 1le8_B, 1du0_A, 4xrm_B, 1mnm_C
Binding Motifs: 3cmy_A GATTAT
Binding Sites: 3cmy_B
3cmy_C
Publications: Birrane G, Soni A, Ladias J.A. Structural basis for DNA recognition by the human PAX3 homeodomain. Biochemistry 48:1148-55 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.