Transcription Factor

						

			
Accessions: 4eot_B (3D-footprint 20231221)

			
Names: MAFA_HUMAN, Pancreatic beta-cell-specific transcriptional activator, RIPE3b1 factor, Transcription factor MafA, V-maf musculoaponeurotic fibrosarcoma oncogene homolog A
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8NHW3
Length: 92
Pfam Domains:      1-91 bZIP Maf transcription factor
Sequence: 
(in bold interface residues)		   1 FSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEK   60
  61 CQLQSQVEQLKLEVGRLAKERDLYKEKYEKLA
Interface Residues: 34, 38, 41, 42, 45, 46
3D-footprint Homologues: 7x5e_E, 7x5e_F, 2wt7_B, 4eot_A, 2wt7_A
Binding Motifs: 4eot_AB tGCnnACTnnGCa
Binding Sites: 4eot_C
4eot_D
			
Publications: Lu X, Guanga G.P, Wan C, Rose R.B. A Novel DNA Binding Mechanism for maf Basic Region-Leucine Zipper Factors Inferred from a MafA-DNA Complex Structure and Binding Specificities. Biochemistry : (2012). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.