Transcription Factor

Accessions: bowl (FlyZincFinger 1.0 )
Names: CG10021
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 147
Pfam Domains: 7-27 Zinc-finger of C2H2 type
7-29 Zinc finger, C2H2 type
7-24 C2H2-type zinc finger
7-29 C2H2-type zinc finger
21-45 Zinc-finger double domain
35-57 Zinc finger, C2H2 type
35-55 C2H2-type zinc finger
35-57 C2H2-type zinc finger
49-72 Zinc-finger double domain
63-83 C2H2-type zinc finger
63-85 Zinc finger, C2H2 type
63-86 C2H2-type zinc finger
79-101 Zinc-finger double domain
90-109 C2H2-type zinc finger
91-113 C2H2-type zinc finger
91-113 Zinc finger, C2H2 type
92-110 Zinc-finger of C2H2 type
105-129 Zinc-finger double domain
118-129 C2H2-type zinc finger
119-141 C2H2-type zinc finger
119-141 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 SRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKE 60
61 KPFKCTECGKGFCQSRTLAVHKILHMEESPHKCPVCSRSFNQRSNLKTHLLTHTDHKPYE 120
121 CSSCGKVFRRNCDLRRHALTHAVGEVN
Interface Residues: 17, 18, 19, 20, 21, 23, 24, 25, 26, 27, 30, 35, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 73, 74, 75, 76, 77, 79, 80, 82, 83, 88, 102, 103, 104, 105, 106, 107, 108, 122, 128, 129, 130, 131, 132, 133, 135, 136, 137
3D-footprint Homologues: 1tf3_A, 5v3j_F, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 5kl3_A, 5ei9_F, 6ml4_A, 1f2i_J, 7w1m_H, 6blw_A, 1tf6_A, 5yel_A, 2gli_A, 1g2f_F, 5kkq_D, 4x9j_A, 8ssu_A, 1llm_D, 8h9h_G, 4m9v_C, 7ysf_A, 6e94_A, 8gh6_A, 7y3m_I, 2jpa_A, 1ubd_C, 2kmk_A, 7txc_E, 5k5i_A, 6u9q_A, 8ssq_A, 2wbs_A, 2lt7_A, 6jnm_A, 6a57_A, 1yuj_A, 8gn3_A, 2drp_D, 3oym_A, 5yj3_D
Binding Motifs: bowl_SANGER_5_FBgn0004893 mCrGwAGY
bowl_SOLEXA_FBgn0004893 mmammCrGTAGCmm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.