Transcription Factor

Accessions: 5ei9_F (3D-footprint 20260701)
Names: [histone H3]-lysine36 N-trimethyltransferase PRDM9, [histone H3]-lysine4 N-trimethyltransferase PRDM9, [histone H3]-lysine9 N-trimethyltransferase PRDM9, [histone H4]-lysine20 N-methyltransferase PRDM9, [histone H4]-N-methyl-L-lysine20 N-methyltransferase PRDM9, EC 2.1.1.-, EC 2.1.1.354, EC 2.1.1.355, EC 2.1.1.359, EC 2.1.1.361, EC 2.1.1.362, Histone-lysine N-methyltransferase PRDM9, PR domain zinc finger protein 9, PR domain-containing protein 9, PRDM9_HUMAN, Protein-lysine N-methyltransferase PRDM9
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9NQV7
Length: 110
Pfam Domains: 3-25 C2H2-type zinc finger
3-25 C2H2-type zinc finger
3-25 Zinc finger, C2H2 type
17-40 Zinc-finger double domain
31-53 Zinc finger, C2H2 type
31-53 C2H2-type zinc finger
31-53 C2H2-type zinc finger
45-68 Zinc-finger double domain
59-81 C2H2-type zinc finger
59-81 Zinc finger, C2H2 type
59-81 C2H2-type zinc finger
73-98 Zinc-finger double domain
87-109 C2H2-type zinc finger
87-109 Zinc finger, C2H2 type
87-109 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYV 60
61 CRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHT
Interface Residues: 3, 13, 14, 15, 16, 17, 19, 20, 22, 23, 26, 41, 42, 43, 44, 45, 47, 48, 49, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 81, 97, 98, 99, 100, 101, 103, 104
3D-footprint Homologues: 2kmk_A, 6jnm_A, 5v3j_F, 1tf3_A, 7w1m_H, 1tf6_A, 6u9q_A, 5ei9_F, 5kl3_A, 5k5i_A, 8ssq_A, 1llm_D, 5k5l_F, 8ssu_A, 2gli_A, 1f2i_J, 5kkq_D, 6e94_A, 2lt7_A, 7ysf_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 3uk3_C, 7n5w_A, 1g2f_F, 2drp_D, 6blw_A, 6ml4_A, 5yel_A, 4x9j_A, 8h9h_G, 4m9v_C, 7y3m_I, 6a57_A, 2wbs_A, 7txc_E, 8gn3_A, 8ebt_K, 8ebx_K, 6dta_B, 5yj3_D
Binding Motifs: 5ei9_F tGGCTAGGGAGGCa
Binding Sites: 5ei9_C
5ei9_D
Publications: Patel A, Horton JR, Wilson GG, Zhang X, Cheng X. Structural basis for human PRDM9 action at recombination hot spots. Genes Dev 30:257-65 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.