Transcription Factor
Accessions: | 5ei9_F (3D-footprint 20231221) |
Names: | [histone H3]-lysine36 N-trimethyltransferase PRDM9, [histone H3]-lysine4 N-trimethyltransferase PRDM9, [histone H3]-lysine9 N-trimethyltransferase PRDM9, [histone H4]-lysine20 N-methyltransferase PRDM9, [histone H4]-N-methyl-L-lysine20 N-methyltransferase PRDM9, EC 2.1.1.-, EC 2.1.1.354, EC 2.1.1.355, EC 2.1.1.359, EC 2.1.1.361, EC 2.1.1.362, Histone-lysine N-methyltransferase PRDM9, PR domain zinc finger protein 9, PR domain-containing protein 9, PRDM9_HUMAN, Protein-lysine N-methyltransferase PRDM9 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q9NQV7 |
Length: | 110 |
Pfam Domains: | 3-25 C2H2-type zinc finger 3-25 Zinc finger, C2H2 type 3-25 C2H2-type zinc finger 17-40 Zinc-finger double domain 31-53 C2H2-type zinc finger 31-53 C2H2-type zinc finger 31-53 Zinc finger, C2H2 type 45-68 Zinc-finger double domain 59-81 C2H2-type zinc finger 59-81 C2H2-type zinc finger 59-81 Zinc finger, C2H2 type 73-98 Zinc-finger double domain 87-109 C2H2-type zinc finger 87-109 C2H2-type zinc finger 87-109 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 KPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYV 60 61 CRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHT |
Interface Residues: | 3, 13, 14, 15, 16, 17, 19, 20, 22, 23, 26, 41, 42, 43, 44, 45, 47, 48, 49, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 81, 97, 98, 99, 100, 101, 103, 104 |
3D-footprint Homologues: | 2kmk_A, 5v3j_F, 1tf3_A, 7w1m_H, 6jnm_A, 1llm_D, 5kkq_D, 5ei9_F, 5kl3_A, 8ssq_A, 1f2i_J, 6u9q_A, 5k5i_A, 5und_A, 8ssu_A, 2gli_A, 5k5l_F, 1tf6_A, 7eyi_G, 2i13_A, 6e94_A, 7ysf_A, 6wmi_A, 2lt7_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 4x9j_A, 6blw_A, 6ml4_A, 5yel_A, 1mey_C, 2drp_D, 1g2f_F, 8h9h_G, 4m9v_C, 7y3m_I, 6a57_A, 2wbs_A, 7txc_E, 8gn3_A, 8ebt_K, 8ebx_K, 6dta_B, 5yj3_D |
Binding Motifs: | 5ei9_F tGGCTAGGGAGGCa |
Binding Sites: | 5ei9_C 5ei9_D |
Publications: | Patel A, Horton JR, Wilson GG, Zhang X, Cheng X. Structural basis for human PRDM9 action at recombination hot spots. Genes Dev 30:257-65 (2016). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.