Transcription Factor
Accessions: | T000669_1.02 (CISBP 1.02), Q9SUE3 (JASPAR 2024), T20031 (AthalianaCistrome v4_May2016) |
Names: | CRF4, T000669_1.02;, CRF4_ARATH, Ethylene-responsive transcription factor CRF4, Protein CYTOKININ RESPONSE FACTOR 4, AT4G27950, T20031; |
Organisms: | Arabidopsis thaliana |
Libraries: | CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
Notes: | experiment type:PBM, family:AP2, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP |
Length: | 335 |
Pfam Domains: | 116-166 AP2 domain |
Sequence: (in bold interface residues) | 1 MMMDEFMDLRPVKYTEHKTVIRKYTKKSSMERKTSVRDSARLVRVSMTDRDATDSSSDEE 60 61 EFLFPRRRVKRLINEIRVEPSSSSTGDVSASPTKDRKRINVDSTVQKPSVSGQNQKKYRG 120 121 VRQRPWGKWAAEIRDPEQRRRIWLGTFATAEEAAIVYDNAAIKLRGPDALTNFTVQPEPE 180 181 PVQEQEQEPESNMSVSISESMDDSQHLSSPTSVLNYQTYVSEEPIDSLIKPVKQEFLEPE 240 241 QEPISWHLGEGNTNTNDDSFPLDITFLDNYFNESLPDISIFDQPMSPIQPTENDFFNDLM 300 301 LFDSNAEEYYSSEIKEIGSSFNDLDDSLISDLLLV |
Interface Residues: | 122, 124, 126, 130, 132, 134, 141, 143 |
3D-footprint Homologues: | 7wq5_A |
Binding Motifs: | M0033_1.02 sCGCCGCC MA0976.1 sCGCCGCC M0079 ygRCGGCGGCGghgg M0131 cckCCGCCGCCrCcdcckCcg MA0976.2 cCGCCGCCrCcr MA0976.3 cCGCCGCCrC |
Binding Sites: | MA0976.2.1 MA0976.2.10 / MA0976.2.6 MA0976.2.11 / MA0976.2.7 MA0976.2.12 / MA0976.2.9 MA0976.2.13 MA0976.2.14 MA0976.2.11 / MA0976.2.15 MA0976.2.12 / MA0976.2.13 / MA0976.2.16 / MA0976.2.19 MA0976.2.17 MA0976.2.18 MA0976.2.2 MA0976.2.20 MA0976.2.3 MA0976.2.4 MA0976.2.3 / MA0976.2.5 MA0976.2.6 MA0976.2.4 / MA0976.2.7 MA0976.2.5 / MA0976.2.8 MA0976.2.9 MA0976.3.1 MA0976.3.15 / MA0976.3.16 MA0976.3.12 / MA0976.3.13 MA0976.3.11 / MA0976.3.8 / MA0976.3.9 MA0976.2.10 MA0976.2.14 MA0976.2.15 MA0976.2.16 MA0976.2.17 MA0976.2.18 MA0976.2.19 MA0976.2.20 MA0976.2.8 MA0976.3.10 / MA0976.3.7 MA0976.3.14 MA0976.3.17 MA0976.3.18 MA0976.3.19 / MA0976.3.4 MA0976.3.2 MA0976.3.20 MA0976.3.3 MA0976.3.5 MA0976.3.6 |
Publications: | Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.