Transcription Factor
| Accessions: | 2ypb_A (3D-footprint 20231221) |
| Names: | bHLHa17, Class A basic helix-loop-helix protein 17, Stem cell protein, T-CELL ACUTE LYMPHOCYTIC LEUKEMIA PROTEIN 1, T-cell leukemia/lymphoma protein 5, TAL-1, TAL1_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P17542 |
| Length: | 67 |
| Pfam Domains: | 8-59 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA 60 61 KLLNDQE |
| Interface Residues: | 9, 12, 13, 15, 16, 17, 19, 20, 45 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 6od3_F, 1am9_A, 2ql2_D, 2ypa_B, 2ql2_A, 4h10_A, 7ssa_L, 6g1l_A, 8osl_P, 7d8t_A |
| Binding Motifs: | 2ypb_AB GnaCAnaTG |
| Publications: | El Omari K, Hoosdally S.J, Tuladhar K, Karia D, Hall-Ponselé E, Platonova O, Vyas P, Patient R, Porcher C, Mancini E.J. Structural basis for LMO2-driven recruitment of the SCL:E47bHLH heterodimer to hematopoietic-specific transcriptional targets. Cell reports 4:135-47 (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.