Transcription Factor

Accessions: 1qne_B (3D-footprint 20231221), 1vto_B (3D-footprint 20231221)
Names: AtTBP1, TATA sequence-binding protein 1, TATA-binding factor 1, TATA-box factor 1, TATA-box-binding protein 1, TBP-1, TBP1_ARATH, Transcription initiation factor TFIID TBP-1 subunit, TRANSCRIPTION INITIATION FACTOR TFIID-1, TATA BINDING PROTEIN
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P28147
Length: 188
Pfam Domains: 13-95 Transcription factor TFIID (or TATA-binding protein, TBP)
100-186 Transcription factor TFIID (or TATA-binding protein, TBP)
Sequence:
(in bold interface residues)
1 PVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTT 60
61 ALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRL 120
121 EGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYP 180
181 VLSEFRKI
Interface Residues: 17, 19, 47, 48, 62, 64, 70, 72, 106, 107, 109, 138, 139, 153, 155, 161, 163
3D-footprint Homologues: 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D, 6cnb_R, 1cdw_A, 5iy6_P, 7z7n_D, 1qna_B, 5n9g_G
Binding Motifs: 1qne_B cTtTTATA
1vto_B TATAAaAg
Binding Sites: 1qne_E / 1vto_E
1qne_F / 1vto_F
Publications: Patikoglou G.A, Kim J.L, Sun L, Yang S.H, Kodadek T, Burley S.K. TATA element recognition by the TATA box-binding protein has been conserved throughout evolution. Genes & development 13:3217-30 (1999). [Pubmed]

Kim J.L, Burley S.K. 1.9 A resolution refined structure of TBP recognizing the minor groove of TATAAAAG. Nature structural biology 1:638-53 (1994). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.